MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFAASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFA
QIIHWYIAEQIKYWRQTRG
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2h9d:D | 100 | 99 | 0.9899 | 0.9800 | 0.9899 | 1.11e-68 | 2h9c:A, 2h9c:B, 2h9d:B, 2h9d:C, 3hgw:D, 3hgx:A, 3rem:A, 3rem:B, 3ret:B |
2 | 2h9d:A | 84 | 94 | 0.8485 | 1.0000 | 0.8936 | 3.45e-55 | |
3 | 4ll2:B | 224 | 69 | 0.1818 | 0.0804 | 0.2609 | 0.59 | 4oei:A, 4oei:B, 3s18:A, 3s18:B, 3v6n:A, 3v6n:B, 4yeh:A, 4yeh:B |
4 | 7rj1:A | 265 | 46 | 0.1515 | 0.0566 | 0.3261 | 0.98 | 7rj1:B, 7rj1:C, 7rj1:D |
5 | 7aor:z | 1071 | 42 | 0.1717 | 0.0159 | 0.4048 | 1.1 | |
6 | 6hiv:Cv | 1059 | 43 | 0.1616 | 0.0151 | 0.3721 | 3.0 | 6hiw:Cv, 6hiy:Cv, 7pub:Cv |
7 | 5en7:A | 177 | 31 | 0.1010 | 0.0565 | 0.3226 | 3.3 | 5en6:A, 5en7:C, 5en7:E, 5en7:G |
8 | 7mq9:LM | 2005 | 54 | 0.1515 | 0.0075 | 0.2778 | 3.9 | |
9 | 7mqa:LM | 2041 | 54 | 0.1515 | 0.0073 | 0.2778 | 3.9 | |
10 | 6q8j:A | 188 | 37 | 0.1111 | 0.0585 | 0.2973 | 4.5 | |
11 | 4iqj:A | 1164 | 28 | 0.1313 | 0.0112 | 0.4643 | 4.8 | |
12 | 4iqj:D | 1185 | 28 | 0.1313 | 0.0110 | 0.4643 | 4.9 | 3e0d:A, 3e0d:B, 2hpi:A, 2hpm:A, 4iqj:B, 4iqj:C |
13 | 2exr:A | 491 | 38 | 0.1212 | 0.0244 | 0.3158 | 5.9 | 2q4w:A |
14 | 4nx1:A | 308 | 65 | 0.2020 | 0.0649 | 0.3077 | 8.3 | 4nx1:B, 4ovp:A, 4ovp:B |