MKRRPRKWKKKGRMRWKWIKKRIRRLKKQRRKERGLI
The query sequence (length=37) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tmf:c | 37 | 37 | 1.0000 | 1.0000 | 1.0000 | 4.09e-16 | 6skf:Bk, 6skg:Bk, 6sw9:0, 6swc:0, 6swd:0, 6th6:Bk, 7zag:0, 7zah:0, 7zai:0, 7zhg:0 |
2 | 4v6u:BW | 72 | 24 | 0.2973 | 0.1528 | 0.4583 | 6.0 | 6skf:BZ, 6skg:BZ, 6th6:BZ, 4v4n:AW |
3 | 3cvv:A | 519 | 26 | 0.2162 | 0.0154 | 0.3077 | 7.0 | 7ayv:A, 7azt:A, 8c1u:A, 8c69:A, 8c6a:A, 8c6b:A, 8c6c:A, 8c6f:A, 8c6h:A, 3cvu:A, 3cvw:A, 3cvx:A, 3cvy:A, 7qut:A, 2wb2:A, 2wq6:A, 2wq7:A |
4 | 9c4g:c | 274 | 20 | 0.2432 | 0.0328 | 0.4500 | 7.1 | 8crx:c, 8cvm:c |