MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPK
The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1aw6:A | 43 | 43 | 1.0000 | 1.0000 | 1.0000 | 1.97e-24 | |
2 | 3coq:A | 89 | 36 | 0.8372 | 0.4045 | 1.0000 | 1.17e-20 | 3coq:B, 1d66:A, 1d66:B, 7uik:T, 7uik:U, 7uio:GA, 7uio:GB |
3 | 1cld:A | 33 | 33 | 0.4884 | 0.6364 | 0.6364 | 2.67e-07 | |
4 | 1pyi:A | 88 | 29 | 0.3488 | 0.1705 | 0.5172 | 0.009 | 1pyi:B |
5 | 2hap:C | 76 | 25 | 0.2791 | 0.1579 | 0.4800 | 0.092 | 2hap:D, 1hwt:C, 1hwt:D, 1hwt:G, 1hwt:H, 1pyc:A, 1qp9:A, 1qp9:B, 1qp9:C, 1qp9:D |
6 | 1ajy:A | 71 | 31 | 0.3023 | 0.1831 | 0.4194 | 2.1 | 1ajy:B, 1zme:C, 1zme:D |
7 | 7ciw:A | 216 | 15 | 0.1860 | 0.0370 | 0.5333 | 3.5 | 7civ:A, 7cix:A |
8 | 8gju:J | 689 | 29 | 0.2558 | 0.0160 | 0.3793 | 4.6 | 8gju:K, 8gju:L, 8gju:H |
9 | 2xiq:A | 714 | 29 | 0.2558 | 0.0154 | 0.3793 | 4.6 | 8dyj:B, 8dyl:B, 2xij:A, 2xiq:B |
10 | 7yhq:A | 393 | 23 | 0.2326 | 0.0254 | 0.4348 | 5.9 | |
11 | 7yhp:A | 374 | 23 | 0.2326 | 0.0267 | 0.4348 | 7.1 | 7yho:A |
12 | 1kg5:A | 225 | 20 | 0.1860 | 0.0356 | 0.4000 | 9.7 | 1kg2:A, 1kg3:A, 1kg4:A, 1kg6:A, 1kg7:A, 1kqj:A, 1mud:A, 1mun:A, 1muy:A, 1wef:A, 1weg:A, 1wei:A |