BioLiP

>protein
MKLFRVVKRGYYISYAILDNSTIIRLDEDPIKALMRYSENKEVLGDRVTGIDYQSLLKSFQINDIRITKPIDPPEVWGSG
ISYEMARERYSEENVAKILGKTIYEKVYDAVRPEIFFKATPNRCVGHGEAIAVRSDSEWTLPEPELAVVLDSNGKILGYT
IMDDVSARDLEAENPLYLPQSKIYAGCCAFGPVIVTSDEIKNPYSLDITLKIVREGRVFFEGSVNTNKMRRKIEEQIQYL
IRDNPIPDGTILTTGTAIVPGRDKGLKDEDIVEITISNIGTLITPVKKRRK

The query sequence (length=291) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3bqb:X	291	291	1.0000	1.0000	1.0000	0.0	3bqb:A, 3bqb:Z, 3bqb:Y, 2q1a:X, 2q1c:X, 2q1d:X
2	6iym:A	277	190	0.1924	0.2022	0.2947	5.14e-14	6iym:B
3	4dbh:A	269	242	0.2199	0.2379	0.2645	1.61e-12	4dbf:A, 4dbf:B, 4dbh:B
4	8sky:B	303	186	0.1959	0.1881	0.3065	1.88e-12	8sky:A, 8sut:A, 8sut:B, 8suu:A, 8suu:B
5	3qdf:A	252	226	0.2302	0.2659	0.2965	3.16e-09
6	8gsr:A	290	197	0.1821	0.1828	0.2690	2.60e-08	8gsr:B, 8gsr:C, 8gsr:D, 8gst:A, 8gst:B, 8gst:C, 8gst:D
7	6j5x:A	280	159	0.1375	0.1429	0.2516	2.65e-05	6j5x:B
8	6v77:B	279	215	0.1753	0.1828	0.2372	5.35e-04	6v77:A
9	6sbi:A	216	159	0.1409	0.1898	0.2579	0.005	6sbi:B, 6sbi:C, 6sbi:D, 6sbj:A, 6sbj:B, 6sbj:C, 6sbj:D
10	3r6o:A	265	205	0.1684	0.1849	0.2390	0.016
11	6jvw:B	264	101	0.0962	0.1061	0.2772	0.20	6jvw:A
12	3zkn:A	375	47	0.0515	0.0400	0.3191	8.2	7d5b:A, 7d5u:A, 2ewy:A, 2ewy:B, 2ewy:C, 2ewy:D, 7f1g:A, 6jsz:A, 7n4n:A, 6uj0:A, 6uj0:B, 6uj1:A, 6uj1:B, 3zki:A, 3zki:B, 3zkn:B, 3zks:A, 3zlq:A, 3zlq:B

[Back]