MKKYRVQPDGRFELKRFDPDDTSAFEGGKQAALEALAVLNRRLEKLQELLYAEGQHKVLVVLQAMDAGGKDGTIRVVFDG
VNPSGVRVASFGVPTEQELARDYLWRVHQQVPRKGELVIFNRSHYEDVLVVRVKNLVPQQVWQKRYRHIREFERMLADEG
TTILKFFLHISKDEQRQRLQERLDNPEKRWKFRMGDLEDRRLWDRYQEAYEAAIRETSTEYAPWYVIPANKNWYRNWLVS
HILVETLEGLAMQYPQP
The query sequence (length=257) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5o6m:D | 264 | 257 | 0.9961 | 0.9697 | 0.9961 | 0.0 | 5lc9:B, 5lc9:C, 5lc9:D, 5lcd:A, 5lcd:B, 5lcd:C, 5lcd:D, 5ld1:A, 5ld1:D, 5ld1:B, 5ld1:C, 5ldb:A, 5ldb:B, 5ldb:C, 5ldb:D, 5maq:A, 5maq:B, 5maq:C, 5maq:D, 5o6k:A, 5o6k:B, 5o6k:C, 5o6k:D, 5o6m:A, 5o6m:B, 5o6m:C |
2 | 6aqe:B | 266 | 255 | 0.4591 | 0.4436 | 0.4627 | 6.01e-83 | 6aqe:A, 7nmj:A, 7nmj:B, 7nmj:C, 7nmj:D, 7plj:A, 7plj:B, 7plj:C, 7plj:D |
3 | 6anh:A | 300 | 268 | 0.4591 | 0.3933 | 0.4403 | 9.31e-76 | 6an9:A, 6ang:A, 6aqn:A, 6au0:A, 6b18:A |
4 | 5llf:D | 266 | 178 | 0.2451 | 0.2368 | 0.3539 | 1.44e-32 | 5ll0:A, 5ll0:B, 5ll0:C, 5ll0:D, 5llb:A, 5llb:B, 5llb:C, 5llb:D, 5llf:A, 5llf:B, 5llf:C |
5 | 6dzg:A | 288 | 213 | 0.2685 | 0.2396 | 0.3239 | 1.46e-29 | 6dzg:B, 6dzg:C, 6dzg:D |
6 | 1xs5:A | 240 | 51 | 0.0584 | 0.0625 | 0.2941 | 0.94 | |
7 | 3nua:B | 237 | 36 | 0.0623 | 0.0675 | 0.4444 | 0.95 | 3nua:A |
8 | 3gvp:A | 433 | 105 | 0.1051 | 0.0624 | 0.2571 | 2.3 | 3gvp:B, 3gvp:C, 3gvp:D, 3mtg:A, 3mtg:B |
9 | 7ef9:A | 414 | 104 | 0.1051 | 0.0652 | 0.2596 | 4.7 | 7ef8:A |
10 | 1war:A | 310 | 41 | 0.0506 | 0.0419 | 0.3171 | 5.6 | 2bq8:X |
11 | 6jdd:A | 176 | 50 | 0.0584 | 0.0852 | 0.3000 | 5.8 | |
12 | 8ag6:B | 975 | 24 | 0.0506 | 0.0133 | 0.5417 | 6.8 | 2o8b:B, 2o8c:B, 2o8d:B, 2o8e:B, 2o8f:B |