MKKILAINFSTASKKGEGTGYAFRKDGQVYVGSIKAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRNRK
HSITLANCNGYFIGAIDGLVNGYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYCEHL
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ktz:A | 160 | 160 | 1.0000 | 1.0000 | 1.0000 | 1.05e-118 | 4ktz:B |
2 | 8pv6:Cz | 103 | 25 | 0.0750 | 0.1165 | 0.4800 | 0.58 | 8i9t:Cz, 8i9v:Cz, 8i9w:Cz, 8i9x:Cz, 8i9y:Cz, 8i9z:Cz, 8ia0:Cz, 8pv1:Cz, 8pv2:Cz, 8pv3:Cz, 8pv4:Cz, 8pv5:Cz, 8pv7:Cz, 8pv8:Cz, 8pvk:Cz, 8pvl:Cz |
3 | 3ngl:A | 275 | 78 | 0.1187 | 0.0691 | 0.2436 | 1.1 | 3ngl:C |
4 | 2htv:A | 388 | 69 | 0.1187 | 0.0490 | 0.2754 | 1.5 | 2htv:B, 2htw:A |
5 | 6ezn:F | 650 | 46 | 0.1187 | 0.0292 | 0.4130 | 2.0 | 8agb:A, 8age:A, 6c26:A, 7oci:F |
6 | 8agc:A | 697 | 46 | 0.1187 | 0.0273 | 0.4130 | 2.0 | |
7 | 6fb3:A | 1836 | 22 | 0.0688 | 0.0060 | 0.5000 | 4.1 | 6fb3:B, 6fb3:C, 6fb3:D, 6ska:A, 6ske:A, 6ske:C |
8 | 3vyk:A | 128 | 63 | 0.1000 | 0.1250 | 0.2540 | 6.2 | |
9 | 7r2e:A | 244 | 51 | 0.1000 | 0.0656 | 0.3137 | 6.3 | 7r2e:B |
10 | 5txe:A | 652 | 38 | 0.0563 | 0.0138 | 0.2368 | 9.5 | 5txe:B |