MKKIEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQQGGMQIQFRGRTMEVTLLPKVKLEIVVKDDAVEEVIGLIVNS
AFTGSPGDGKIFIIPVEDVVRIRTGERGDDSLEHH
The query sequence (length=115) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ncr:C | 116 | 115 | 1.0000 | 0.9914 | 1.0000 | 3.48e-79 | 3ncq:A, 3ncq:B, 3ncq:C, 3ncr:A, 3ncr:B |
2 | 3ta1:D | 115 | 115 | 0.6000 | 0.6000 | 0.6000 | 2.01e-42 | 3ta1:A, 3ta1:C, 3ta1:B, 3ta1:E, 3ta1:F, 3ta2:A, 3ta2:B, 3ta2:C |
3 | 2j9e:B | 119 | 116 | 0.5913 | 0.5714 | 0.5862 | 5.55e-41 | 2j9c:A, 2j9c:C, 2j9c:B, 2j9d:C, 2j9d:E, 2j9d:F, 2j9d:I, 2j9d:J, 2j9d:L, 2j9e:A, 2j9e:C, 7p52:A |
4 | 7p4v:A | 113 | 112 | 0.5565 | 0.5664 | 0.5714 | 4.01e-40 | |
5 | 7p50:A | 121 | 108 | 0.5391 | 0.5124 | 0.5741 | 3.18e-38 | 7p50:B, 7p50:C |
6 | 2j9d:B | 103 | 112 | 0.5217 | 0.5825 | 0.5357 | 9.19e-33 | 2j9d:H, 2j9d:K |
7 | 2xbp:A | 113 | 112 | 0.5130 | 0.5221 | 0.5268 | 2.62e-31 | 4aff:A, 4c3k:C, 4c3k:F, 2xul:A, 2xul:B, 2xul:C, 2xul:D, 2xul:E, 2xul:F, 2xzw:A, 2xzw:B, 2xzw:C, 2xzw:D, 2xzw:F, 2xzw:G, 2xzw:H, 2xzw:I |
8 | 3n5b:A | 112 | 112 | 0.4957 | 0.5089 | 0.5089 | 1.15e-30 | 8wm7:E |
9 | 3ta0:C | 99 | 106 | 0.5217 | 0.6061 | 0.5660 | 1.23e-30 | 3ta0:A, 3ta0:B, 3ta0:D, 3ta0:E, 3ta0:F |
10 | 3lf0:B | 112 | 112 | 0.4522 | 0.4643 | 0.4643 | 6.53e-30 | 3lf0:C |
11 | 2eg2:A | 95 | 112 | 0.5304 | 0.6421 | 0.5446 | 1.86e-29 | |
12 | 2rd5:D | 126 | 110 | 0.4870 | 0.4444 | 0.5091 | 6.89e-28 | 2rd5:C |
13 | 2ns1:B | 113 | 112 | 0.4174 | 0.4248 | 0.4286 | 5.46e-27 | 2nuu:G, 2nuu:H, 2nuu:I, 2nuu:J, 2nuu:K, 2nuu:L |
14 | 4cnz:E | 112 | 112 | 0.4435 | 0.4554 | 0.4554 | 7.53e-27 | 4cnz:C, 4cnz:F, 4co0:A, 4co0:B, 4co1:A, 4co1:B, 4co2:A, 4co2:B, 4co3:A, 4co3:B, 3mhy:A, 3mhy:C, 3mhy:B |
15 | 4c3k:D | 101 | 115 | 0.4783 | 0.5446 | 0.4783 | 6.10e-25 | 4c3k:A, 4c3k:E, 8wm7:F, 2xzw:E |
16 | 8wm7:G | 94 | 108 | 0.4609 | 0.5638 | 0.4907 | 1.43e-24 | |
17 | 3lf0:A | 99 | 112 | 0.4087 | 0.4747 | 0.4196 | 1.09e-23 | |
18 | 2o66:B | 108 | 109 | 0.4348 | 0.4630 | 0.4587 | 1.84e-23 | 2o66:A, 2o66:C, 2o67:A, 2o67:B, 2o67:C |
19 | 6yc7:A | 105 | 112 | 0.4174 | 0.4571 | 0.4286 | 2.00e-23 | 6yc7:B, 6yc7:E, 6yc7:C |
20 | 4ozn:A | 116 | 112 | 0.4522 | 0.4483 | 0.4643 | 1.36e-22 | 4ozj:A, 4ozn:C |
21 | 5l9n:A | 92 | 109 | 0.4435 | 0.5543 | 0.4679 | 1.96e-22 | |
22 | 4cnz:A | 100 | 112 | 0.4174 | 0.4800 | 0.4286 | 2.05e-22 | 4cny:A, 4cnz:B, 4cnz:D, 4co4:A, 4co4:C, 4co4:B, 3o5t:B, 5ovo:B |
23 | 6yc7:F | 94 | 112 | 0.4000 | 0.4894 | 0.4107 | 2.19e-22 | |
24 | 4usj:C | 142 | 107 | 0.4348 | 0.3521 | 0.4673 | 5.33e-21 | 4usi:A, 4usi:C, 4usi:B, 4usj:D |
25 | 1ul3:B | 94 | 112 | 0.4348 | 0.5319 | 0.4464 | 5.33e-21 | 1ul3:C |
26 | 7o4x:A | 103 | 112 | 0.3913 | 0.4369 | 0.4018 | 7.99e-21 | |
27 | 2gnk:A | 95 | 112 | 0.3739 | 0.4526 | 0.3839 | 7.08e-20 | |
28 | 4rx6:B | 115 | 112 | 0.3478 | 0.3478 | 0.3571 | 2.67e-17 | 4r25:A, 4rx6:A, 4rx6:D |
29 | 4ozl:A | 104 | 112 | 0.4087 | 0.4519 | 0.4196 | 3.52e-17 | 4ozn:B |
30 | 1v3s:A | 97 | 106 | 0.4087 | 0.4845 | 0.4434 | 1.99e-16 | 1v3s:B, 1v3s:C, 1v9o:A, 1v9o:B, 1v9o:C |
31 | 5hei:A | 246 | 24 | 0.0870 | 0.0407 | 0.4167 | 4.2 | 5hei:B, 5hei:C, 5hei:D, 5hei:E, 5hei:F, 5hei:G, 5hei:H |
32 | 1rqg:A | 606 | 55 | 0.1391 | 0.0264 | 0.2909 | 4.5 | |
33 | 6rop:B | 831 | 62 | 0.1565 | 0.0217 | 0.2903 | 6.7 | |
34 | 5my0:A | 852 | 62 | 0.1565 | 0.0211 | 0.2903 | 7.5 | 5my0:C, 5my0:D, 5my2:D, 6rop:A, 6rop:C, 6rop:D |
35 | 8arp:C | 445 | 95 | 0.1913 | 0.0494 | 0.2316 | 8.6 | 8arp:A, 8arp:B, 8arp:D, 8arp:E, 8arp:F |
36 | 3cdx:A | 329 | 34 | 0.0957 | 0.0334 | 0.3235 | 9.8 | 3cdx:B, 3cdx:C, 3cdx:D, 3cdx:E, 3cdx:F |