BioLiP

>protein
MKKDSKAPCVEVFDERDGCKAAGTQKASGDDGFCVKVSMKAIGFNAAEAASVTKNYGIKRFGA

The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4lmx:C	66	63	1.0000	0.9545	1.0000	9.89e-41	8el3:A, 8el3:J, 8el3:G, 8el3:K, 8el4:A, 8el4:F, 8el5:A, 8el5:J, 8el5:K, 8el5:G, 8el6:A, 8el6:F
2	4lmx:E	66	63	0.8889	0.8485	0.8889	2.57e-35	8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K
3	4lm6:A	62	58	0.5397	0.5484	0.5862	8.50e-18	4lm6:C
4	7s96:A	63	59	0.5714	0.5714	0.6102	5.38e-17	7s96:C, 7s97:C, 7t89:A, 7t89:C
5	7ssf:A	72	48	0.4127	0.3611	0.5417	1.23e-09	7ssf:C, 7ssf:E, 7ssf:G
6	7t7u:A	81	55	0.3492	0.2716	0.4000	8.76e-05
7	7t7u:C	70	58	0.3651	0.3286	0.3966	1.05e-04
8	7t8s:D	70	60	0.3968	0.3571	0.4167	1.66e-04	7t8s:H, 7t8s:L, 7t8s:P
9	4lms:A	80	50	0.3492	0.2750	0.4400	2.25e-04
10	7t8s:B	78	54	0.3492	0.2821	0.4074	0.002	7t8s:F, 7t8s:J, 7t8s:N
11	7tja:G	67	60	0.3810	0.3582	0.4000	0.007	7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O
12	1qgw:A	76	61	0.3016	0.2500	0.3115	0.027	1xf6:A, 1xg0:A
13	7tja:I	75	42	0.2698	0.2267	0.4048	0.049	7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M
14	7sut:A	78	65	0.3968	0.3205	0.3846	0.059	7sut:E
15	1qgw:B	67	41	0.2857	0.2687	0.4390	0.67	1xf6:B, 1xg0:B
16	6kz8:A	784	39	0.2063	0.0166	0.3333	8.0	6kz8:B, 6kz9:A
17	2lua:A	52	29	0.1111	0.1346	0.2414	8.3	4rkg:B, 4rkh:D, 4rkh:E, 4rkh:C, 4rkh:F

[Back]