BioLiP

>protein
MKFGIEFVPSDPALKIAYYAKLSEQQGFDHVWITDHYNNRDVYSTLTVLALNTNSIKIGPGVTNSYTRNPAITASSIASI
AEISGGRAVLGLGPGDKATFDAMGIAWKKPLATTKEAIQAIRDFISGKKVSMDGEMIKFAGAKLAFKAGNIPIYMGAQGP
KMLELAGEIADGVLINASHPKDFEVAVEQIKKGAEKAGRDPSEVDVTAYACFSIDKDPVKAVNAAKVVVAFIVAGSPDLV
LERHGIPVEAKSQIGAAIAKGDFGALMGGLVTPQMIEAFSICGTPDDCMKRIKDLEAIGVTQIVAGSPIGPAKEKAIKLI
GKEIIAK

The query sequence (length=327) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1z69:A	327	327	1.0000	1.0000	1.0000	0.0	1z69:B, 1z69:C, 1z69:D
2	8qpl:A	331	327	0.6239	0.6163	0.6239	1.83e-143	8qpl:B
3	1ezw:A	347	342	0.5566	0.5245	0.5322	3.85e-121
4	3b4y:A	332	324	0.2232	0.2199	0.2253	1.52e-18	3b4y:B
5	1rhc:A	330	301	0.2294	0.2273	0.2492	1.20e-17
6	3fgc:A	349	341	0.2294	0.2149	0.2199	3.76e-09
7	7bip:B	329	238	0.1835	0.1824	0.2521	6.72e-06
8	5wan:A	341	203	0.1529	0.1466	0.2463	4.75e-04	6sgg:AAA, 6sgl:AAA, 6sgm:AAA, 6sgn:AAA, 6tee:AAA, 6tef:AAA, 6teg:AAA
9	3td9:A	350	68	0.0581	0.0543	0.2794	0.12
10	5aec:A	364	46	0.0520	0.0467	0.3696	0.70	5aec:B, 4uwm:A, 4uwm:B
11	3b9o:A	433	64	0.0520	0.0393	0.2656	0.92	3b9o:B
12	6s1m:A	1010	46	0.0459	0.0149	0.3261	3.5	6s1n:A, 6s1o:A, 6tny:A, 6tnz:A
13	6r6h:E	310	111	0.0826	0.0871	0.2432	6.2	4d10:E, 4d10:M, 4d18:E, 4d18:M, 8h38:E, 8h3a:E, 8h3f:E, 5jog:A, 5joh:A, 5m5q:A, 6r7i:E, 4wsn:E, 4wsn:M, 4wsn:U, 4wsn:c, 4wsn:k, 4wsn:s
14	5mss:A	717	61	0.0520	0.0237	0.2787	6.7	5mst:A, 5mst:B, 5msw:A

[Back]