MIPPPEKVRMNSVNFKNILQWEVPAFPKTQLTFTAQYESYRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSE
WVQVTFCPVEDTIIGPPEMQIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKQGTNEKFQVVSPYDSEVLR
NLEPWTTYCIQVQGFLLDQQRTGEWSEPICERTGN
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6weo:O | 196 | 195 | 1.0000 | 0.9949 | 1.0000 | 1.58e-148 | 6weo:K, 6weo:C |
2 | 6e3k:E | 213 | 217 | 0.3179 | 0.2911 | 0.2857 | 1.03e-15 | 6e3k:I, 6e3l:E, 6e3l:I, 5eh1:A |
3 | 3dgc:R | 202 | 145 | 0.1692 | 0.1634 | 0.2276 | 0.005 | |
4 | 6weo:7 | 201 | 146 | 0.1590 | 0.1542 | 0.2123 | 0.022 | 6weo:F, 6weo:M, 6weo:V |
5 | 7o31:H | 221 | 57 | 0.0769 | 0.0679 | 0.2632 | 0.25 | 7ucx:H |
6 | 6u42:5H | 135 | 57 | 0.0974 | 0.1407 | 0.3333 | 0.43 | |
7 | 6uag:A | 97 | 96 | 0.1282 | 0.2577 | 0.2604 | 0.94 | 6uag:B, 6uag:C, 6uag:D, 6uag:E, 6uag:F, 6ug4:A, 6ug4:B, 6ug4:C, 6ug4:D, 6ug4:E, 6ug4:F |
8 | 1i8i:B | 119 | 55 | 0.0769 | 0.1261 | 0.2727 | 1.6 | 1i8k:B |
9 | 1eba:A | 212 | 73 | 0.1077 | 0.0991 | 0.2877 | 1.9 | 1eba:B, 1ebp:A, 1ebp:B |
10 | 2ivf:C | 214 | 52 | 0.0821 | 0.0748 | 0.3077 | 3.1 | |
11 | 2p6r:A | 683 | 78 | 0.1231 | 0.0351 | 0.3077 | 6.0 | |
12 | 7bvd:A | 499 | 135 | 0.1590 | 0.0621 | 0.2296 | 7.8 |