MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHL
The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2bsq:A | 143 | 139 | 0.9784 | 0.9510 | 0.9784 | 2.32e-99 | 2h1c:A, 2h1o:A |
2 | 8iuf:1A | 352 | 44 | 0.1079 | 0.0426 | 0.3409 | 0.17 | 8j9h:1A, 8j9i:1A, 8j9j:1A |
3 | 7xjp:B | 509 | 44 | 0.1151 | 0.0314 | 0.3636 | 2.0 | |
4 | 7tbj:A5 | 1276 | 105 | 0.2086 | 0.0227 | 0.2762 | 3.5 | 5hax:A, 5hb0:B, 5hb0:C, 5hb0:A, 7tbi:A1, 7tbi:A2, 7tbi:A3, 7tbi:A4, 7tbj:A1, 7tbj:A3, 7tbj:A6, 7tbk:A1, 7tbk:A3, 7tbk:A5, 7tbk:A6, 7tbl:A1, 7tbl:A3, 7tbl:A5, 7tbl:A6, 7tbm:A1, 7tbm:A3, 7tbm:A5, 7tbm:A6 |
5 | 4rwn:A | 349 | 43 | 0.1079 | 0.0430 | 0.3488 | 4.3 | 4rwo:A, 4rwp:A |
6 | 1gxc:A | 116 | 34 | 0.0863 | 0.1034 | 0.3529 | 5.0 | 1gxc:D, 1gxc:G, 1gxc:J |
7 | 4uqv:G | 429 | 53 | 0.1223 | 0.0396 | 0.3208 | 7.3 | 4uqv:A, 4uqv:B, 4uqv:C, 4uqv:D, 4uqv:E, 4uqv:F, 4uqv:H, 4uqv:I, 4uqv:J, 4uqv:K, 4uqv:L |
8 | 3qjj:A | 243 | 50 | 0.1151 | 0.0658 | 0.3200 | 9.1 | 3qjj:B, 3qjl:A, 3qjl:B, 3qjp:A |