MIEPLLLGIVLGLIPVTLAGLFVAAYLQYKRGNQF
The query sequence (length=35) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7zxy:G | 35 | 35 | 1.0000 | 1.0000 | 1.0000 | 1.06e-18 | 7r0w:O, 7r0w:G, 7zxy:O |
2 | 7zyv:G | 34 | 34 | 0.7714 | 0.7941 | 0.7941 | 8.49e-14 | |
3 | 1q90:G | 30 | 29 | 0.6857 | 0.8000 | 0.8276 | 2.93e-11 | |
4 | 2e76:G | 37 | 34 | 0.6571 | 0.6216 | 0.6765 | 6.79e-04 | 4h13:G, 4i7z:G, 4pv1:G |
5 | 3hbz:A | 341 | 29 | 0.3429 | 0.0352 | 0.4138 | 6.2 | |
6 | 8fux:A | 322 | 15 | 0.2857 | 0.0311 | 0.6667 | 7.3 | 8fuw:A, 8fux:B, 6mgc:A |
7 | 5ys3:A | 188 | 31 | 0.4000 | 0.0745 | 0.4516 | 8.1 | 5ys3:C, 5ys3:B, 5ys8:A, 5ys8:B, 5ys8:C |
8 | 5a7v:A | 368 | 18 | 0.2571 | 0.0245 | 0.5000 | 8.7 | 5a7v:B |
9 | 7vgf:A | 550 | 34 | 0.3429 | 0.0218 | 0.3529 | 9.6 | 7vgf:B |