MHKDELLELHEQMVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNALAAAMSEDEFSSAGRISKR
MEELADDAS
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2gf4:A | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 4.83e-60 | 2gf4:B |
| 2 | 4zm6:A | 844 | 30 | 0.1236 | 0.0130 | 0.3667 | 3.8 | 4zm6:B |
| 3 | 3ab3:A | 322 | 24 | 0.1348 | 0.0373 | 0.5000 | 5.1 | 3ab3:C, 3cx6:A, 3cx7:A, 3cx8:A, 1zcb:A |
| 4 | 5kvv:A | 327 | 28 | 0.1461 | 0.0398 | 0.4643 | 9.1 | 5kvv:B |
umich.edu