MHHHHNLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGA
IREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHK
TPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGA
VKKASAPGQISVADLRTVLTILHQA
The query sequence (length=265) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4guh:B | 265 | 265 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 4gug:A, 4gug:B, 4guh:A, 4gui:A, 4gui:B, 4guj:A, 4guj:B, 4iuo:A, 4iuo:B, 3m7w:A, 3m7w:B, 3m7w:C, 3m7w:D, 3m7w:E, 3m7w:F, 3nnt:A, 3nnt:B |
2 | 8b2b:AAA | 252 | 252 | 0.7283 | 0.7659 | 0.7659 | 8.47e-144 | 8b2b:BBB, 8b2c:AAA, 4clm:B, 4cno:A, 4cno:B, 4cno:C, 4cno:D, 4cnp:A, 4cnp:B, 6h5c:A, 6h5c:B, 6h5d:A, 6h5d:B, 6h5g:A, 6h5j:A, 1l9w:A, 1l9w:B, 1l9w:C, 1l9w:D, 1qfe:A, 1qfe:B, 6sfe:A, 6sfe:B, 6sfg:A, 4uio:A |
3 | 4h3d:B | 254 | 251 | 0.5283 | 0.5512 | 0.5578 | 5.15e-100 | 4h3d:A, 4h3d:C, 4h3d:D, 3js3:A, 3js3:B, 3js3:C, 3js3:D |
4 | 8b2a:BBB | 238 | 219 | 0.2830 | 0.3151 | 0.3425 | 1.33e-34 | 8b2a:AAA, 1sfj:A, 1sfj:B, 6sfh:A, 6sfh:B |
5 | 2o7q:A | 501 | 229 | 0.2642 | 0.1397 | 0.3057 | 5.90e-20 | 6bmb:A, 6bmq:A, 2gpt:A, 2o7s:A |
6 | 6hqv:A | 1555 | 219 | 0.1925 | 0.0328 | 0.2329 | 1.16e-04 | 6hqv:B |
7 | 8dek:B | 441 | 83 | 0.0906 | 0.0544 | 0.2892 | 1.1 | 8dek:A, 8df2:A, 8df2:B, 8df2:C, 8df2:D |
8 | 4cvq:A | 404 | 29 | 0.0415 | 0.0272 | 0.3793 | 2.3 | 4cvq:B |
9 | 5k1s:A | 358 | 100 | 0.1245 | 0.0922 | 0.3300 | 2.3 | 5k1s:C, 5k1s:B, 5k1s:D |
10 | 7uor:A | 379 | 11 | 0.0377 | 0.0264 | 0.9091 | 2.6 | 1f4t:A, 1f4t:B, 1f4u:A, 1f4u:B, 1io7:A, 1io7:B, 1io8:A, 1io8:B, 1io9:A, 1io9:B, 4tt5:A, 4tuv:A, 7uor:B, 7uor:C, 7uor:D, 7uor:E, 7uor:F, 4wpd:A, 4wpd:B, 4wqj:A |
11 | 5wp6:A | 977 | 70 | 0.0981 | 0.0266 | 0.3714 | 2.8 | 6bqv:A, 6bqv:C, 6bqv:B, 6bqv:D, 5wp6:B, 5wp6:C, 5wp6:D |
12 | 2wja:A | 146 | 53 | 0.0642 | 0.1164 | 0.3208 | 3.9 | 2wja:B |
13 | 3t4k:A | 268 | 53 | 0.0604 | 0.0597 | 0.3019 | 4.3 | 3t4j:A, 3t4j:B, 3t4k:B, 3t4l:A, 3t4l:B, 3t4o:A, 3t4o:B, 3t4q:A, 3t4q:B, 3t4s:A, 3t4s:B, 3t4t:A, 3t4t:B |
14 | 2qm3:A | 338 | 15 | 0.0415 | 0.0325 | 0.7333 | 4.6 | |
15 | 3ddd:A | 281 | 21 | 0.0377 | 0.0356 | 0.4762 | 4.8 | |
16 | 7xij:A | 131 | 16 | 0.0340 | 0.0687 | 0.5625 | 7.1 | |
17 | 4luj:A | 214 | 94 | 0.1057 | 0.1308 | 0.2979 | 8.1 | 4luj:B |
18 | 6tg9:G | 148 | 46 | 0.0491 | 0.0878 | 0.2826 | 8.7 | 6tg9:C, 6tga:G, 6tga:C |
19 | 5fdn:A | 914 | 139 | 0.1208 | 0.0350 | 0.2302 | 9.3 | 5fdn:B |