MGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENAS
The query sequence (length=93) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7x5e:E |
101 |
92 |
0.9785 |
0.9010 |
0.9891 |
1.23e-60 |
3a5t:A, 3a5t:B, 7x5e:A, 7x5f:A, 7x5f:E, 7x5g:A, 7x5g:E |
2 |
2wty:B |
97 |
89 |
0.5591 |
0.5361 |
0.5843 |
2.12e-31 |
4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A |
3 |
4eot:A |
92 |
89 |
0.5591 |
0.5652 |
0.5843 |
1.92e-30 |
4eot:B |
4 |
7x5e:B |
106 |
82 |
0.2366 |
0.2075 |
0.2683 |
1.0 |
7x5e:F, 7x5f:B, 7x5f:F, 7x5g:B, 7x5g:F |
5 |
7vuk:B |
472 |
17 |
0.1075 |
0.0212 |
0.5882 |
2.2 |
|
6 |
8pnt:A |
749 |
80 |
0.2151 |
0.0267 |
0.2500 |
2.4 |
8by6:A, 6d0y:C, 1n52:A, 5oo6:D, 5oo6:G, 5oo6:J, 5oo6:M, 5oo6:P, 5oob:I, 5oob:A, 8pmp:A |
7 |
2e5w:A |
280 |
53 |
0.1720 |
0.0571 |
0.3019 |
3.9 |
2e5w:C, 2zsu:A, 2zsu:C, 2zsu:E |
8 |
9eq5:A |
511 |
42 |
0.1613 |
0.0294 |
0.3571 |
6.4 |
9eq5:D, 9eq5:B, 9eq5:C |
9 |
1e8w:A |
851 |
41 |
0.1505 |
0.0165 |
0.3415 |
7.5 |
2a5u:A, 4anu:A, 4anw:A, 4anx:A, 4aof:A, 3apc:A, 3apd:A, 3apf:A, 6aud:A, 6c1s:A, 2chw:A, 2chx:A, 2chz:A, 3csf:A, 3cst:A, 3dbs:A, 4dk5:A, 3dpd:A, 1e7v:A, 1e8x:A, 1e8z:A, 1e90:A, 5eds:A, 3ene:A, 4ezj:A, 4ezk:A, 4ezl:A, 4f1s:A, 4fa6:A, 4fad:A, 4fjy:A, 4fjz:A, 4flh:A, 4ful:A, 4g11:A, 5g2n:A, 5g55:A, 4gb9:A, 4hle:A, 4j6i:A, 7jwz:A, 5kae:A, 7kke:A, 4kz0:A, 3l08:A, 3l13:A, 3l16:A, 3l17:A, 3l54:A, 3ml8:A, 3ml9:A, 3nzs:A, 3oaw:A, 5oq4:A, 3pre:A, 3prz:A, 3ps6:A, 4ps3:A, 4ps7:A, 4ps8:A, 3qaq:A, 3qar:A, 3r7q:A, 3r7r:A, 3s2a:A, 8sc8:A, 3t8m:A, 3tjp:A, 3tl5:A, 4urk:A, 2v4l:A, 4wwn:A, 6xrl:A, 4xx5:A, 4xz4:A, 7z61:A |