MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPL
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5j0n:F | 356 | 64 | 1.0000 | 0.1798 | 1.0000 | 2.26e-42 | 5j0n:E, 5j0n:G, 5j0n:H, 1p7d:A, 1p7d:B, 2wcc:3, 1z19:B, 1z19:A, 1z1b:B, 1z1b:A, 1z1g:A, 1z1g:D, 1z1g:B, 1z1g:C |
2 | 6x2f:A | 1144 | 48 | 0.2500 | 0.0140 | 0.3333 | 0.77 | 7ssg:A, 6x26:A, 6x2n:A, 6x43:A, 6x4w:A, 6x4y:A, 6x50:A |
3 | 6pij:A | 351 | 36 | 0.2031 | 0.0370 | 0.3611 | 0.92 | 8fuk:A, 8fuk:B, 8fuk:C, 8fuk:D, 8fuk:E, 6lnb:G, 6lnb:F, 6lnb:E, 6lnb:D, 6lnb:C, 6lnc:G, 6lnc:F, 6lnc:E, 6lnc:D, 6lnc:C, 6pif:A, 6pif:B, 6pif:C, 6pif:D, 6pif:E, 6pig:A, 6pig:B, 6pig:C, 6pig:D, 6pig:E, 6pij:B, 6pij:C, 6pij:D, 6pij:E, 6uvn:G, 6uvn:F, 6uvn:E, 6uvn:H, 6uvn:D, 6v9q:B, 6v9q:C, 6v9q:D, 6v9q:E, 6v9q:F, 6vbw:B, 6vbw:C, 6vbw:D, 6vbw:F, 6vbw:E |
4 | 6pif:F | 310 | 36 | 0.2031 | 0.0419 | 0.3611 | 0.96 | 8fuk:F, 6lnb:B, 6lnc:B, 6pig:F, 6pij:F, 6uvn:C, 6v9q:G, 6vbw:G |
5 | 4mvt:A | 255 | 22 | 0.1406 | 0.0353 | 0.4091 | 6.2 | 4mvt:B, 4mvt:C, 4mvt:D |
6 | 5egh:B | 393 | 37 | 0.2031 | 0.0331 | 0.3514 | 7.4 | 5ege:A, 5ege:B, 5ege:C, 5ege:D, 5egh:A |
7 | 4dxy:A | 406 | 29 | 0.1562 | 0.0246 | 0.3448 | 7.7 | 3nv5:A, 3nv6:A |