MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVWLIFGSWCVSVFFPALFATEK
MFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFLYLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGRF
SSLIVLTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLYAIFSLSFFISVWTSE
RLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLR
The query sequence (length=284) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8vy9:R | 290 | 286 | 1.0000 | 0.9793 | 0.9930 | 0.0 | 9iiw:R, 9iix:R, 9ij9:R, 9ija:R, 8vy7:R, 8xql:R, 8xqn:R, 8xqo:R, 8xqp:R, 8xqr:R, 8xqs:R, 8xqt:R, 8yky:R |
2 | 7xp6:R | 283 | 282 | 0.4789 | 0.4806 | 0.4823 | 4.78e-69 | |
3 | 5lwe:B | 285 | 208 | 0.1690 | 0.1684 | 0.2308 | 0.55 | 5lwe:A |
4 | 6lkn:A | 1064 | 89 | 0.0915 | 0.0244 | 0.2921 | 0.82 | 6lkn:E, 6lkn:I, 6lkn:M |
5 | 7bsp:A | 1028 | 89 | 0.0915 | 0.0253 | 0.2921 | 0.96 | 7bsq:A, 7vsh:A |
6 | 2p4q:A | 476 | 94 | 0.0880 | 0.0525 | 0.2660 | 2.0 | |
7 | 7yw4:A | 120 | 65 | 0.0739 | 0.1750 | 0.3231 | 5.5 |