BioLiP

>protein
MGFEGMFTKKEGQWDCSVCLVRNEASATKCIACQNPGK

The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mnt:B	38	38	1.0000	1.0000	1.0000	1.43e-23	7mnt:D, 7mnu:B
2	7mns:B	38	38	0.8158	0.8158	0.8158	2.45e-19
3	7mnr:B	40	38	0.6842	0.6500	0.6842	4.91e-15
4	7mnp:B	39	33	0.5526	0.5385	0.6364	1.18e-11	7mnp:D, 7mnq:B
5	7mnv:B	38	32	0.6053	0.6053	0.7188	3.21e-11
6	7mo5:B	36	29	0.5000	0.5278	0.6552	2.46e-09
7	7mo2:B	38	35	0.4474	0.4474	0.4857	7.68e-08	3ch5:B, 7mo2:D
8	2ebq:A	47	25	0.3684	0.2979	0.5600	3.38e-06	2gqe:A, 2k0c:A
9	2ebv:A	57	39	0.4474	0.2982	0.4359	9.86e-06
10	2ebr:A	47	26	0.3947	0.3191	0.5769	1.32e-05
11	2d9g:A	53	24	0.3947	0.2830	0.6250	2.63e-05
12	7mo3:B	38	34	0.3421	0.3421	0.3824	6.39e-05	7mo3:D, 7mo4:B, 7mo4:D
13	8pp6:K	36	23	0.3684	0.3889	0.6087	0.001
14	7mo1:B	34	21	0.2895	0.3235	0.5238	0.003
15	3a9j:C	32	25	0.2105	0.2500	0.3200	0.31	9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C
16	8f5o:B	1134	21	0.2368	0.0079	0.4286	1.5	8f5p:B
17	8f5o:B	1134	33	0.3421	0.0115	0.3939	5.0	8f5p:B
18	6u04:A	168	33	0.3421	0.0774	0.3939	2.4	5erc:A
19	6jk8:B	801	26	0.2105	0.0100	0.3077	6.6
20	6jk8:A	823	26	0.2105	0.0097	0.3077	7.3	1igr:A, 7v3p:B
21	4y4v:A	316	15	0.2105	0.0253	0.5333	8.2	4y4v:B
22	7sl4:A	786	32	0.3158	0.0153	0.3750	9.1	8dtm:B

[Back]