BioLiP

>protein
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKIE

The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1yjt:A	75	75	0.9867	0.9867	0.9867	6.15e-50	1yjv:A
2	8ioy:A	816	71	0.6400	0.0588	0.6761	1.45e-27
3	7si6:A	873	69	0.6000	0.0515	0.6522	7.13e-26	7si3:A, 7si7:A
4	7si6:A	873	66	0.4000	0.0344	0.4545	1.80e-12	7si3:A, 7si7:A
5	6a71:B	71	66	0.3867	0.4085	0.4394	2.59e-16	6a72:A
6	1y3j:A	77	64	0.3867	0.3766	0.4531	6.19e-14
7	1s6u:A	76	74	0.3867	0.3816	0.3919	3.01e-12
8	1kvj:A	79	69	0.3467	0.3291	0.3768	1.02e-11	3cjk:B, 2k1r:A, 5t7l:B
9	3dxs:X	74	70	0.3600	0.3649	0.3857	5.53e-11
10	1fvs:A	72	66	0.2933	0.3056	0.3333	1.42e-10	2ggp:B
11	1oq6:A	76	62	0.3200	0.3158	0.3871	5.66e-10
12	1kqk:A	80	65	0.2667	0.2500	0.3077	8.07e-09
13	1k0v:A	73	68	0.2933	0.3014	0.3235	2.03e-07	3i9z:A, 2qif:A, 2qif:B
14	6ff2:A	67	61	0.2267	0.2537	0.2787	1.12e-05	6ff2:B
15	4a48:B	69	67	0.2667	0.2899	0.2985	1.33e-05	4a48:A, 4a4j:A, 2xmw:A
16	1mwz:A	73	43	0.2000	0.2055	0.3488	0.002
17	1afj:A	72	66	0.2133	0.2222	0.2424	0.004
18	4tkp:B	63	54	0.2133	0.2540	0.2963	0.018
19	8q74:A	783	71	0.2533	0.0243	0.2676	0.17	8q75:A, 8q76:A
20	8jfk:B	1033	44	0.2133	0.0155	0.3636	0.30	8jfk:N, 8jfk:J, 8jfk:F, 8jfl:B, 8jfl:N, 8jfl:F, 8jfl:J, 8xya:B
21	1txc:A	157	33	0.1467	0.0701	0.3333	2.9	1txc:B
22	2qim:A	157	34	0.1600	0.0764	0.3529	5.4	3e85:A, 5mxb:A, 5mxw:A
23	4s28:A	520	54	0.1733	0.0250	0.2407	5.7	4n7q:A, 4s25:A, 4s26:A, 4s26:B, 4s27:A, 4s29:A
24	6gqf:A	168	49	0.2267	0.1012	0.3469	7.9	6gqf:B, 6gqf:C, 6gqf:D
25	1jfi:B	135	21	0.1200	0.0667	0.4286	8.6

[Back]