MFVKQVFFDLGARIHADEARALVAKLLDDTQPGLVSALMNYMPASKTSKTEFPLVQFSNFNQGFALLGFGEVGAQILSDA
TPIIHDAMAKLFASRGQGVVVQVSSRDVPLSCEKRPYGLQYTVAKMVVQKKHEHRERLANPETGKVFLEGLFLRSLERQA
AAVGMVLPRDLVVSFKGAERVSSVKLRPDSTLAHGSLRHAVFEVNARLGGLWSVGFLLSKGFGHINTDLQLGQG
The query sequence (length=234) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xfz:H | 234 | 234 | 1.0000 | 1.0000 | 1.0000 | 1.88e-173 | 7xg0:H, 7xg2:H, 7xg3:H, 7xg4:H |
2 | 3ebl:A | 323 | 134 | 0.1410 | 0.1022 | 0.2463 | 0.027 | 3ebl:B, 3ebl:C, 3ebl:D, 3ebl:E, 3ebl:F, 3ed1:A, 3ed1:B, 3ed1:C, 3ed1:D, 3ed1:E, 3ed1:F |
3 | 5iqc:A | 301 | 183 | 0.1667 | 0.1296 | 0.2131 | 0.034 | 5byl:A, 5byl:B, 5byl:C, 5byl:D, 6c5u:A, 6c5u:B, 6c5u:C, 6c5u:D, 6cav:A, 6cav:B, 6cav:C, 6cav:D, 6cey:A, 6cey:B, 6cey:C, 6cey:D, 6cgd:A, 6cgd:B, 6cgd:C, 6cgd:D, 6cgg:A, 6cgg:B, 6cgg:C, 6cgg:D, 6ch4:A, 6ch4:B, 6ch4:C, 6ch4:D, 5iqa:A, 5iqa:B, 5iqa:C, 5iqa:D, 5iqb:A, 5iqb:B, 5iqb:C, 5iqb:D, 5iqc:B, 5iqc:C, 5iqc:D, 5iqd:A, 5iqd:B, 5iqd:C, 5iqd:D, 5iqe:A, 5iqe:B, 5iqe:C, 5iqe:D, 5iqf:A, 5iqf:B, 5iqf:C, 5iqf:D, 5iqg:A, 5iqg:B, 5iqg:C, 5iqg:D, 5iqh:A, 5iqh:B, 5iqh:C, 5iqh:D, 5iqi:A, 5iqi:B, 5iqi:C, 5iqi:D, 4ork:A, 4ork:B, 4ork:C, 4ork:D |
4 | 6h9h:A | 250 | 186 | 0.1966 | 0.1840 | 0.2473 | 0.43 | 6h9h:B, 6h9i:A, 6h9i:B |
5 | 7qkr:A | 1199 | 45 | 0.0641 | 0.0125 | 0.3333 | 6.4 | 7qks:A |
6 | 4dns:A | 486 | 123 | 0.1325 | 0.0638 | 0.2520 | 7.9 | 4dns:B |
7 | 8tj5:M | 1659 | 83 | 0.0855 | 0.0121 | 0.2410 | 9.7 | 8tj5:O |