MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKL
MAELE
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1j6t:B | 85 | 85 | 1.0000 | 1.0000 | 1.0000 | 4.51e-57 | 1poh:A, 1vrc:C, 1vrc:D |
2 | 8e72:B | 598 | 52 | 0.1529 | 0.0217 | 0.2500 | 0.45 | 8dhw:A, 8dhw:B, 8e72:A |
3 | 6jw7:A | 342 | 22 | 0.1294 | 0.0322 | 0.5000 | 1.2 | 6jw6:A, 6jw6:B, 6jw7:B, 6jw8:A, 6jw8:B |
4 | 1ug9:A | 1019 | 74 | 0.2471 | 0.0206 | 0.2838 | 1.4 | 1ulv:A |
5 | 4lya:A | 521 | 74 | 0.2000 | 0.0326 | 0.2297 | 1.6 | 5fv0:A |
6 | 7w18:A | 212 | 27 | 0.1294 | 0.0519 | 0.4074 | 2.7 | 7w13:A |
7 | 6j5y:A | 233 | 45 | 0.1294 | 0.0472 | 0.2444 | 3.1 | |
8 | 3acs:A | 822 | 30 | 0.1412 | 0.0146 | 0.4000 | 3.7 | 3acs:B, 3act:A, 3act:B, 3afj:A, 3afj:B, 2cqs:A, 2cqs:B, 2cqt:A, 2cqt:B, 3qfy:A, 3qfy:B, 3qfz:A, 3qfz:B, 3qg0:A, 3qg0:B |
9 | 2anr:A | 155 | 27 | 0.1412 | 0.0774 | 0.4444 | 4.2 | 2ann:A |
10 | 5fv0:B | 458 | 74 | 0.2000 | 0.0371 | 0.2297 | 8.4 | |
11 | 3s4a:A | 822 | 30 | 0.1412 | 0.0146 | 0.4000 | 9.1 | 3s4a:B, 3s4b:A, 3s4b:B, 3s4d:A |
12 | 4uor:A | 418 | 64 | 0.2353 | 0.0478 | 0.3125 | 9.5 | 4uoo:A, 4uoo:B, 4uoo:C, 4uoo:D, 4uoo:E, 4uor:B, 4uor:C, 4uor:D, 4uor:E, 4uor:F, 4uor:G, 4uor:H, 4uor:I, 4uor:J, 4uor:K |