BioLiP

>protein
MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNF
KKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRI
PGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQK
SMLIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIEN
QLKSFESRLY

The query sequence (length=330) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6rqh:R	330	330	1.0000	1.0000	1.0000	0.0	6rql:R, 6rrd:R, 6rui:R, 6ruo:R, 6rwe:R, 6tps:R
2	5w5y:Q	349	351	0.9939	0.9398	0.9345	0.0	5w64:Q, 5w65:Q, 5w66:Q
3	5n61:R	303	328	0.8818	0.9604	0.8872	0.0
4	5tka:A	167	34	0.0333	0.0659	0.3235	0.87
5	5tk6:A	191	34	0.0333	0.0576	0.3235	1.0	5tk7:A, 5tk8:A, 5tk9:A
6	2n2x:B	30	28	0.0303	0.3333	0.3571	5.0
7	8frp:F	223	34	0.0364	0.0538	0.3529	6.2
8	7ccf:A	405	67	0.0667	0.0543	0.3284	7.6	5gwe:A, 5gwe:B, 5gwe:C, 5gwe:D, 5xjn:A
9	8a1d:A	533	70	0.0485	0.0300	0.2286	8.7	8a1d:B, 8a1d:C, 8a1d:D, 8a1d:E, 8a1d:F, 8a1d:G, 8a1d:H, 8a1d:I, 8a1d:J, 8a1d:K, 8a1d:L, 8a1d:M, 8a1d:N, 8a1d:O, 8a1d:P, 8a1s:A, 8a1s:B, 8a1s:C, 8a1s:D, 8a1s:E, 8a1s:F, 8a1s:G, 8a1s:H, 8a1s:I, 8a1s:J, 8a1s:K, 8a1s:L, 8a1s:M, 8a1s:N, 8a1s:O, 8a1s:P
10	8qa6:A	553	62	0.0545	0.0325	0.2903	9.1	8qa6:B
11	7xhn:K	230	87	0.0848	0.1217	0.3218	9.6	7xho:K

[Back]