MFEKLYSAIIYSDEFKKILLGRGVDDLEIASAYIAFLYEDLPIIGKNLCAAFLRMGLDAVYNVMPSGKVYSPRHKLYPIS
RYGIDGVCINCDGGKIILRISNKGYDPEDLLESKGLESRIFVSKNFKKKSMEIIEKIWDVNKIRLIARKEILERISAGGI
LHMIR
The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8yk9:D | 165 | 165 | 1.0000 | 1.0000 | 1.0000 | 9.74e-118 | 8yk9:B, 8yk9:C |
2 | 8z9e:G | 175 | 45 | 0.0970 | 0.0914 | 0.3556 | 1.4 | |
3 | 3q4r:A | 170 | 86 | 0.1394 | 0.1353 | 0.2674 | 1.6 | 3q4o:A, 3q4q:A |
4 | 3vyr:B | 371 | 64 | 0.1333 | 0.0593 | 0.3438 | 1.9 | 3vys:B, 3vyt:B, 3vyu:B, 2z1d:A, 2z1d:B |
5 | 1m0w:A | 481 | 75 | 0.1091 | 0.0374 | 0.2400 | 2.0 | 1m0w:B |
6 | 3viu:A | 703 | 117 | 0.2061 | 0.0484 | 0.2906 | 2.7 | |
7 | 6oid:A | 289 | 39 | 0.0788 | 0.0450 | 0.3333 | 6.9 | 6oid:B |
8 | 4unm:B | 609 | 66 | 0.1030 | 0.0279 | 0.2576 | 7.0 | 5lxz:B, 4unm:A |