MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSALPIILANVVTLFFVTIILYYKLT
E
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5uhs:A | 81 | 81 | 1.0000 | 1.0000 | 1.0000 | 3.08e-53 | 5uhs:B |
| 2 | 8qsr:A | 383 | 48 | 0.2099 | 0.0444 | 0.3542 | 0.27 | 8qsr:B, 8qst:A, 8qst:B |
| 3 | 2scp:A | 174 | 25 | 0.1358 | 0.0632 | 0.4400 | 2.1 | 2scp:B |
zhanggroup.org