BioLiP

>protein
MENDKGQLVELYVPRKCSATNRIIKAKDHASVQISIAKVDEDGRAIAGENITYALSGYVRGRGEADDSLNRLAQQDGLLK
NVWSYSR

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8c3a:X	87	87	1.0000	1.0000	1.0000	1.96e-60	8c3a:DI, 8cq7:X, 8cq7:DI, 8cqw:X, 8cqw:DI, 8cre:X, 8cre:DI, 8oeq:X, 8oeq:DI, 7pzy:W, 7q08:W, 7q0f:W, 7q0p:W, 7q0r:W, 8q5i:W
2	8bqd:a	87	87	0.8851	0.8851	0.8851	8.62e-54	8bn3:D1, 8bqx:a, 8c83:a, 8cah:a, 8ccs:x, 8cf5:x, 8cku:x, 8cmj:x, 5dat:d1, 5dge:d1, 5dgv:d1, 6eml:a, 8eub:BV, 8evp:BV, 8evq:BV, 8evr:BV, 8evs:BV, 8evt:BV, 8ewb:BV, 8ewc:BV, 6fai:V, 6fyy:V, 6gq1:AL, 6gqv:AL, 6gsm:V, 6gsn:V, 8i7j:V, 5it7:V, 5it9:V, 3j77:21, 3j78:21, 3j80:V, 5juu:SB, 8k2d:SV, 8k82:SV, 5m1j:V2, 7mpi:BV, 7mpj:BV, 7n8b:BV, 5ndv:d1, 7nrd:Sa, 5obm:d1, 7osa:eS21, 7osm:eS21, 6q8y:a, 6rbd:V, 6rbe:V, 8rw1:V, 6s47:BW, 8s8d:V, 8s8e:V, 8s8f:V, 8s8i:V, 6snt:V, 6sv4:a, 6t4q:SV, 6t7t:SV, 6tnu:a, 4u3n:D1, 4u4n:D1, 4u4o:D1, 4u4y:D1, 4u50:d1, 4u53:D1, 4v6i:AT, 4v8y:AV, 4v8z:AV, 4v92:BV, 6xiq:AL, 6xir:AL, 6z6j:SV, 6z6k:SV, 7zrs:AV, 7zux:DV
3	4v3p:ST	82	75	0.5402	0.5732	0.6267	2.71e-29
4	8r6f:V	81	75	0.5517	0.5926	0.6400	2.55e-28	8ip8:cb, 8ip9:cb, 8ipa:cb
5	7syl:W	83	79	0.5057	0.5301	0.5570	8.99e-28	6gz3:BV, 6olz:BV, 6om0:SV, 6om7:SV, 7oyb:V2, 7tor:AS21, 7wtw:V, 7wtz:V
6	8auv:G	83	75	0.4598	0.4819	0.5333	1.98e-27	8b2l:G1
7	5xxu:V	80	79	0.5172	0.5625	0.5696	3.15e-27
8	6xu8:AV	82	80	0.5287	0.5610	0.5750	7.91e-27
9	7qix:L	82	75	0.4598	0.4878	0.5333	1.20e-26	7qiz:BA
10	6az1:Y	88	80	0.4253	0.4205	0.4625	2.14e-22	8rxh:SY, 8rxx:SY
11	8ova:AR	89	78	0.4138	0.4045	0.4615	5.46e-21
12	7ase:g	83	78	0.3908	0.4096	0.4359	1.03e-20
13	3j7a:Z	72	69	0.4023	0.4861	0.5072	1.66e-19	3jbn:Z, 3jbp:Z, 6okk:Z, 8tpu:SZ
14	4bts:AZ	97	76	0.3678	0.3299	0.4211	5.75e-15	4bts:BZ, 4bts:CZ, 4bts:DZ, 4v5o:AZ, 4v5o:BZ
15	3ild:A	148	48	0.1494	0.0878	0.2708	2.5
16	5xxz:B	1310	20	0.1264	0.0084	0.5500	3.5
17	6vjb:A	1346	20	0.1264	0.0082	0.5500	3.5
18	5xya:A	1358	20	0.1264	0.0081	0.5500	3.5	5xxz:A
19	7edd:A	1394	20	0.1264	0.0079	0.5500	3.6	5xyr:A
20	6am0:A	260	47	0.1724	0.0577	0.3191	4.2	6am0:E, 5lop:A
21	6qw6:S	126	64	0.1954	0.1349	0.2656	4.4	8h6e:4S, 8h6j:4S, 8qp8:S, 8qp9:S, 8qpk:S, 6qx9:S, 8qxd:S, 8r08:S
22	1md9:A	536	47	0.1724	0.0280	0.3191	4.5	1mdb:A
23	8uxw:A	400	57	0.1954	0.0425	0.2982	4.6	8e9b:A, 8uxx:A, 6w17:A
24	5jca:L	471	32	0.1609	0.0297	0.4375	5.2	5jfc:L
25	5vj7:A	462	32	0.1609	0.0303	0.4375	6.3
26	8r0a:S	86	62	0.1954	0.1977	0.2742	9.4

[Back]