MELRHTPARDLDKFIEDHLLPNTCFRTQVKEAIDIVCRFLKERCFQGTADPVRVSKVVKGGSSGKGTTLRGRSDADLVVF
LTKLTSFEDQLRRRGEFIQEIRRQLEACQREQKFKVTFEVQSPRRENPRALSFVLSSPQLQQEVEFDVLPAFDALGQWTP
GYKPNPEIYVQLIKECKSRGKEGEFSTCFTELQRDFLRNRPTKLKSLIRLVKHWYQTCKKTHGNKLPPQYALELLTVYAW
EQGSRKTDFSTAQGFQTVLELVLKHQKLCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILDPADPTGNVGGGDTHSWQRLA
QEARVWLGYPCCKNLDGSLVGAWTML
The query sequence (length=346) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4rwn:A | 349 | 346 | 1.0000 | 0.9914 | 1.0000 | 0.0 | 4rwo:A, 4rwp:A |
2 | 4ig8:A | 338 | 345 | 0.7370 | 0.7544 | 0.7391 | 0.0 | |
3 | 4s3n:A | 343 | 346 | 0.4422 | 0.4461 | 0.4422 | 8.17e-85 | |
4 | 6p8v:G | 320 | 314 | 0.1936 | 0.2094 | 0.2134 | 4.24e-06 | 6p80:A, 6u7b:A, 6u7b:C |
5 | 4atb:A | 334 | 125 | 0.0867 | 0.0898 | 0.2400 | 0.089 | 4at8:A, 4at8:C, 4at9:A, 4atb:C |
6 | 4v4n:AO | 197 | 107 | 0.0925 | 0.1624 | 0.2991 | 2.7 | 4v6u:BO |
7 | 7m7k:B | 432 | 53 | 0.0549 | 0.0440 | 0.3585 | 3.3 | |
8 | 6k35:A | 640 | 75 | 0.0694 | 0.0375 | 0.3200 | 4.1 | 6k35:B |
9 | 6rxx:UV | 1061 | 50 | 0.0578 | 0.0189 | 0.4000 | 5.3 | |
10 | 4fbz:A | 238 | 35 | 0.0434 | 0.0630 | 0.4286 | 6.4 | |
11 | 4gox:A | 275 | 77 | 0.0578 | 0.0727 | 0.2597 | 6.8 | |
12 | 8bh8:A | 523 | 89 | 0.0636 | 0.0421 | 0.2472 | 8.7 | 8bh9:A |
13 | 2bsq:A | 143 | 43 | 0.0434 | 0.1049 | 0.3488 | 9.7 | 2h1c:A, 2h1o:A |