MEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQ
SGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGV
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ub9:B | 165 | 157 | 1.0000 | 0.9515 | 1.0000 | 8.71e-114 | 3ub6:A, 3ub6:B, 3ub8:B, 3ub8:A, 3ub9:A |
2 | 4exo:A | 146 | 88 | 0.1338 | 0.1438 | 0.2386 | 0.001 | |
3 | 6rtp:B | 484 | 78 | 0.1465 | 0.0475 | 0.2949 | 1.0 | 5jsh:B, 5jsk:B, 5jsu:B, 5jsy:B, 5jt1:B, 6ru9:B, 6ruc:B, 2wpn:B, 6z7r:B, 6z7r:D, 6z8j:B, 6z8j:D, 6z8m:B, 6z8o:B, 6z8o:D, 6z9g:B, 6z9g:D, 6z9g:F, 6z9g:H, 6z9o:B, 6za1:B, 3ze6:B, 3ze7:B, 3ze8:B, 3ze9:B, 3zea:B |
4 | 4b9d:B | 295 | 58 | 0.1083 | 0.0576 | 0.2931 | 1.9 | 4b9d:A |
5 | 6mni:A | 258 | 53 | 0.1146 | 0.0698 | 0.3396 | 2.0 | 6mni:B |
6 | 8y9c:B | 1609 | 30 | 0.0573 | 0.0056 | 0.3000 | 6.9 |