MEFIKGFTFGWDSQKGYFKTERAKESLRLMQERTASEYVIVALAALQDTAHSTEVDFQGSHMVDDDELIELIDYAKSLGL
KVILKPTVNCRNGTWRAHINFFDMDIPGEPTWDEWFESYINYQKHYAKIAEKTNCEMFVVGCEMVQAERREDKWRELIAE
VRKDYRGLVTYNTDKYQEDNVKFWDALDVISSSGYYPINDWDRQLDRIEAVVKQYDKPFFFVAAGCPSRSGSALLPNKWD
LEGAINLQEQADYYQVMFEKTASRSWVGGFGLWDWQTYLYDEKDATKNDDYGVFGKPAERVIKAYYQSR
The query sequence (length=309) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5yli:B | 309 | 309 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5yli:A, 5ylk:B, 5ylk:A, 5yll:B, 5yll:A, 5z4t:B, 5z4t:A |
2 | 7dwa:B | 327 | 311 | 0.5210 | 0.4924 | 0.5177 | 6.43e-113 | 7dvj:B, 7dvj:A, 7dw8:A, 7dw8:B, 7dwa:A |
3 | 4cd6:A | 315 | 308 | 0.4272 | 0.4190 | 0.4286 | 4.49e-93 | 4cd7:A, 4cd7:B, 4cd8:A |
4 | 7lcc:A | 1369 | 62 | 0.0647 | 0.0146 | 0.3226 | 0.30 | |
5 | 4imr:A | 258 | 35 | 0.0421 | 0.0504 | 0.3714 | 2.8 | 4imr:B |
6 | 3bww:A | 253 | 94 | 0.0874 | 0.1067 | 0.2872 | 3.8 | |
7 | 5yif:A | 459 | 49 | 0.0518 | 0.0349 | 0.3265 | 6.6 | 5yif:B |
8 | 1hyh:A | 297 | 45 | 0.0485 | 0.0505 | 0.3333 | 8.9 | 1hyh:B, 1hyh:C, 1hyh:D |