BioLiP

>protein
MEELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDF
EEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFT
DRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHI
VNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDK
TEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE

The query sequence (length=388) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4kr6:B	388	388	1.0000	1.0000	1.0000	0.0	4kr6:A, 4kr7:A, 4kr7:B, 4kr9:A, 4kr9:B
2	2c5s:A	372	340	0.3737	0.3898	0.4265	9.59e-82
3	8psn:B	515	182	0.1057	0.0796	0.2253	0.97	8pso:B, 8psq:B, 8pss:B, 8psu:B, 8psx:B, 8psz:B, 8pt2:B, 8pt6:B, 8pt7:B, 8pth:B, 8ptj:B, 8qz8:B
4	6erp:A	1011	91	0.0696	0.0267	0.2967	1.8	6erp:B, 6erq:A, 6erq:B
5	3spa:A	941	91	0.0696	0.0287	0.2967	1.8	7a8p:A
6	9bdc:E	990	91	0.0696	0.0273	0.2967	1.9	9bdd:E, 4boc:A, 5ola:E, 5ola:F, 8u8u:E, 8u8v:E
7	8fgw:C	1342	80	0.0490	0.0142	0.2375	2.1	8fh3:C
8	5bv9:A	701	44	0.0387	0.0214	0.3409	3.0	5cvy:A, 5vma:A
9	1yt8:A	525	71	0.0490	0.0362	0.2676	4.0
10	3bl5:E	199	31	0.0361	0.0704	0.4516	5.7	3bl5:A, 3bl5:B, 3bl5:C, 3bl5:D, 3bl5:F
11	2det:A	365	32	0.0284	0.0301	0.3438	6.8	2der:A, 2der:B, 2deu:A, 2deu:B
12	3d6e:B	186	56	0.0361	0.0753	0.2500	7.1	3d6e:A
13	2v1u:A	382	44	0.0309	0.0314	0.2727	7.6

[Back]