MEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3e6z:X | 80 | 80 | 0.9875 | 0.9875 | 0.9875 | 6.29e-54 | 2qcp:X, 2vb2:X |
2 | 8c2q:A | 100 | 76 | 0.5375 | 0.4300 | 0.5658 | 2.81e-25 | 8bbz:CCC |
3 | 8bwv:B | 80 | 77 | 0.5250 | 0.5250 | 0.5455 | 2.30e-23 | 8bwv:A, 8bwv:C, 8bwv:D, 8bwv:E, 8bwv:F |
4 | 3odh:A | 194 | 73 | 0.2375 | 0.0979 | 0.2603 | 0.29 | 3odh:B, 3odh:E, 3odh:F |
5 | 6mg0:B | 1687 | 41 | 0.1875 | 0.0089 | 0.3659 | 0.54 | |
6 | 6mfz:A | 1789 | 41 | 0.1875 | 0.0084 | 0.3659 | 0.61 | 5es7:A, 5es8:A, 5es8:B, 5es9:A, 6mfw:A, 6mfx:A, 6mfy:A, 6mg0:A, 6ulz:A |
7 | 8fmw:AI | 148 | 27 | 0.1250 | 0.0676 | 0.3704 | 1.4 | 8fn2:I |
8 | 8ayh:B | 951 | 26 | 0.1500 | 0.0126 | 0.4615 | 2.8 | 3frp:A, 3hrz:A, 3hs0:A, 3hs0:F |
9 | 2g42:B | 78 | 32 | 0.1250 | 0.1282 | 0.3125 | 6.9 |