MDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLFEEMDELREAVEKEDWENLRDELLDVANFCMYLWGK
LSVK
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2p06:B | 88 | 83 | 0.9881 | 0.9432 | 1.0000 | 6.73e-57 | 2p06:A |
2 | 2yxh:A | 114 | 41 | 0.2143 | 0.1579 | 0.4390 | 0.090 | 2yxh:B |
3 | 5zvw:A | 335 | 60 | 0.2500 | 0.0627 | 0.3500 | 2.5 | |
4 | 8dwe:A | 355 | 46 | 0.1548 | 0.0366 | 0.2826 | 3.9 | 8dvp:A, 8dvy:A, 8dw0:A, 8dw4:A, 8dw7:A, 8dw7:D, 8dwd:A, 8dwe:D, 8dwf:A, 8dwf:D, 3g0q:A, 5kn8:A, 5kn9:A, 6q0c:A, 1rrq:A, 1rrs:A, 6u7t:A, 1vrl:A, 4yoq:A, 4yph:A, 4ypr:A, 4ypr:B |
5 | 6gov:B | 139 | 55 | 0.1786 | 0.1079 | 0.2727 | 3.9 | 5lm7:B, 5lm7:D, 5ms0:L, 6tqn:B, 6tqo:B |
6 | 8z9x:B | 567 | 47 | 0.1786 | 0.0265 | 0.3191 | 4.0 | 8z9x:A |
7 | 4mag:A | 307 | 42 | 0.1429 | 0.0391 | 0.2857 | 5.1 | 7a5q:A, 7a5q:B |
8 | 4eue:A | 398 | 31 | 0.1310 | 0.0276 | 0.3548 | 6.4 | 4euf:A |
9 | 3rwl:A | 404 | 46 | 0.1667 | 0.0347 | 0.3043 | 6.5 | |
10 | 3sxj:A | 245 | 44 | 0.1667 | 0.0571 | 0.3182 | 7.1 | 3sxj:B, 3t0i:A, 3t0i:B |