MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAQVILL
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1d6g:A | 47 | 47 | 1.0000 | 1.0000 | 1.0000 | 2.46e-29 | |
2 | 5hpj:A | 217 | 35 | 0.2553 | 0.0553 | 0.3429 | 2.5 | |
3 | 1aj8:A | 371 | 39 | 0.2979 | 0.0377 | 0.3590 | 3.9 | 1aj8:B |
4 | 6qkg:B | 664 | 17 | 0.1702 | 0.0120 | 0.4706 | 4.2 | 6qkg:A, 6qkr:A, 6qkr:B, 6qkx:A |
5 | 7eu0:M | 1052 | 23 | 0.1915 | 0.0086 | 0.3913 | 5.6 | |
6 | 7eu1:M | 1055 | 23 | 0.1915 | 0.0085 | 0.3913 | 5.6 | |
7 | 5gxx:A | 600 | 33 | 0.2128 | 0.0167 | 0.3030 | 6.3 | 5gxx:B, 5gxy:A, 5gxy:B, 5gxz:A, 5gxz:B, 5gy0:A, 5gy0:B, 5gy1:A, 5gy1:B |
8 | 6fci:A | 179 | 30 | 0.2766 | 0.0726 | 0.4333 | 7.5 | 6fch:A, 6fch:B, 6fci:D, 6fci:B, 6fci:C, 6fcl:A, 6fcl:B, 6fd4:B, 6fd4:A, 6fd5:A, 6fd5:B, 6fd6:A, 6fd6:B, 6hgp:A, 6hgq:A, 6hgq:C, 6hgq:D, 6hgq:B, 6hgr:A, 6hgr:B, 6hgs:A, 6hgs:B, 1ore:A, 4x44:A, 4x45:B, 1zn7:A, 1zn7:B, 1zn8:A, 1zn8:B, 1zn9:B |