Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7tm3:3 68 68 1.0000 1.0000 1.0000 4.67e-45 8btk:SY, 6fti:y, 6ftj:y, 8oj0:2, 6r7q:YY, 7tut:3, 6w6l:2
2 8gu0:B 450 57 0.2941 0.0444 0.3509 0.092 8gu0:A
3 2rak:A 382 32 0.2206 0.0393 0.4688 1.1
4 7pw9:A 1952 46 0.1765 0.0061 0.2609 1.3 7pw4:A, 7pw5:A, 7pw6:A, 7pw7:A, 7pw8:A, 6z3r:A
5 6syt:A 1896 46 0.1765 0.0063 0.2609 1.5
6 6wby:A 1250 21 0.1324 0.0072 0.4286 2.4
7 6w98:A 1312 21 0.1324 0.0069 0.4286 2.4 6wbx:A
8 6jp9:A 298 21 0.1324 0.0302 0.4286 3.7 6jp9:B, 6jp9:C, 6jp9:D
9 4jol:C 60 30 0.1471 0.1667 0.3333 3.7 4jol:B, 4jol:D, 4jol:A
10 7pt6:8 402 41 0.2059 0.0348 0.3415 4.1 7pt6:H, 7pt7:8, 7v3v:H
11 8jze:l 250 37 0.1618 0.0440 0.2973 4.4 8jzf:l
12 8is4:A 452 41 0.1618 0.0243 0.2683 7.3 8is4:B, 8is5:A, 8is5:B, 7ww2:A, 7ww2:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218