MDPNCSCATDGSCSCAGSCKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKEASDKCSCCA
The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4mt2:A | 61 | 61 | 1.0000 | 1.0000 | 1.0000 | 4.28e-32 | |
| 2 | 1dfs:A | 31 | 31 | 0.4098 | 0.8065 | 0.8065 | 7.03e-10 | |
| 3 | 1dft:A | 30 | 30 | 0.3770 | 0.7667 | 0.7667 | 4.33e-08 |
zhanggroup.org