MDLNFIQVILVIFVAFLAGVEGILDQFHFHQPVIACTLIGLVTGNLLPCLILGGTLQMIALGWANVGAAVAPDAALASIA
SAIILVLGGQGKAGVTSAIAIAVPLAVAGLLLTIIVRTLATGIVHIMDAAAKEGNFRKIEMWQYIAIIMQGVRIAIPAGL
ILAIGAGPVKEMLTAMPVWLTDGLAIGGGMVVAVGYAMVINMMATKEVWPFFAIGFVLATISQLTLIGLGAIGISLALIY
LALSKQG
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xtg:D | 248 | 246 | 0.9960 | 0.9919 | 1.0000 | 1.41e-170 | 7xno:Y, 7xno:D, 7xno:H, 7xtg:H, 7xtg:Y |
2 | 7vlx:Y | 247 | 245 | 0.7368 | 0.7368 | 0.7429 | 6.94e-116 | 7vlx:A, 7vlx:C, 7vly:Y, 7vly:C, 7vly:F |
3 | 8hfs:Y | 249 | 237 | 0.5628 | 0.5582 | 0.5865 | 3.64e-71 | |
4 | 7dyr:Y | 248 | 247 | 0.4899 | 0.4879 | 0.4899 | 1.65e-60 | 7dyr:B, 7dyr:E, 6k1h:Y, 6k1h:E, 6k1h:B |
5 | 3t9q:B | 227 | 85 | 0.1053 | 0.1145 | 0.3059 | 1.9 | 3t91:A, 3t91:B, 3t9q:A |
6 | 4bbj:A | 664 | 32 | 0.0567 | 0.0211 | 0.4375 | 2.1 | 4bev:A, 4byg:A, 3rfu:A, 3rfu:B, 3rfu:C, 3rfu:D |