BioLiP

>protein
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACG

The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1fbm:A	46	46	1.0000	1.0000	1.0000	2.79e-28	1fbm:B, 1fbm:D, 1fbm:E, 1mz9:A, 1mz9:B, 1mz9:C, 1mz9:D, 1mz9:E
2	3wfw:A	138	30	0.2826	0.0942	0.4333	1.1	3wfx:A, 3wfx:B
3	3zs7:A	277	24	0.2174	0.0361	0.4167	1.9
4	6zu5:LPP	81	22	0.1957	0.1111	0.4091	2.8
5	1o7d:A	291	16	0.2174	0.0344	0.6250	3.3
6	7zm7:P	122	26	0.2174	0.0820	0.3846	3.8	7zmb:P, 7zmg:P
7	6k0w:A	528	20	0.1739	0.0152	0.4000	4.9
8	8wpk:B	437	19	0.1957	0.0206	0.4737	5.5	8wpf:B, 8wpp:B
9	7oik:A	4426	27	0.2391	0.0025	0.4074	6.0	7oim:A, 6tax:A, 6tay:A
10	7o3e:L	445	15	0.1739	0.0180	0.5333	6.4
11	5f6c:A	512	30	0.2391	0.0215	0.3667	6.8	8b0j:L, 2bx2:L, 2c4r:L, 5f6c:B, 6g63:A, 6g63:G, 6g63:L, 6g63:N, 2vmk:A, 2vmk:B, 2vrt:D, 2vrt:C
12	4me3:A	246	39	0.2391	0.0447	0.2821	7.3
13	8iao:Aa	412	15	0.1739	0.0194	0.5333	7.7	8iar:Aa, 8ibd:AA, 8ibd:Aa, 8ibg:AA, 8ibg:Aa
14	2c0b:L	488	30	0.2391	0.0225	0.3667	7.8	2vmk:C, 2vrt:A, 2vrt:B
15	1yaa:A	412	14	0.1739	0.0194	0.5714	7.9	1yaa:B, 1yaa:C, 1yaa:D
16	7d6n:D	589	28	0.2609	0.0204	0.4286	9.4	7d6n:A, 7d6n:B, 7d6n:E, 7d6n:C, 7d6n:F, 7d6n:G, 7d6n:J, 7d6n:I, 7d6n:H

[Back]