MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTAT
The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4cyk:A | 41 | 41 | 1.0000 | 1.0000 | 1.0000 | 3.35e-26 | |
2 | 8g99:C | 381 | 8 | 0.1707 | 0.0184 | 0.8750 | 2.5 | |
3 | 9c8v:B | 434 | 8 | 0.1707 | 0.0161 | 0.8750 | 2.5 | 8d0k:E, 8d96:B, 8d9d:B, 5exr:B, 5exr:F, 5f0q:A, 5f0q:B, 5f0s:A, 5f0s:B, 3l9q:A, 7opl:D, 3q36:A, 3q36:B, 8qj7:D, 4rr2:D, 7u5c:B, 8vy3:B |
4 | 8g9f:C | 446 | 8 | 0.1707 | 0.0157 | 0.8750 | 2.5 | 8g9l:B, 8g9o:B, 8ucv:B, 8v6g:C, 8v6h:C, 8v6i:C, 8v6j:C |
5 | 6dhw:A | 170 | 8 | 0.1707 | 0.0412 | 0.8750 | 3.9 | 6dhw:B, 5dqo:A, 5dqo:B, 5dqo:C, 5dqo:D, 5i7m:A, 5i7m:B, 3l9q:B |
6 | 3a3w:A | 329 | 17 | 0.2195 | 0.0274 | 0.5294 | 7.8 | 3a3x:A, 3a4j:A, 3c86:A, 2d2g:A, 2d2h:A, 2d2j:A, 4np7:A, 3ood:A, 3oqe:A, 2r1k:A, 2r1l:A, 2r1m:A, 2r1n:A, 2r1p:A, 3so7:A, 5vej:A, 5w7h:A, 5w7h:B, 3wml:A |