MDEGDKKSPISQVHEIGIKRNMTVHFKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKL
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ekz:A | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 2.79e-51 | |
2 | 6sdw:A | 177 | 70 | 0.5658 | 0.2429 | 0.6143 | 3.95e-22 | 6htu:A, 6htu:B, 6htu:C, 6sdy:A |
3 | 6sdw:A | 177 | 64 | 0.3026 | 0.1299 | 0.3594 | 5.81e-05 | 6htu:A, 6htu:B, 6htu:C, 6sdy:A |
4 | 1di2:A | 69 | 67 | 0.2763 | 0.3043 | 0.3134 | 2.59e-09 | |
5 | 7zpk:C | 233 | 70 | 0.2895 | 0.0944 | 0.3143 | 1.63e-07 | 3adl:A, 5n8l:A, 5n8m:A |
6 | 7zpk:C | 233 | 68 | 0.3421 | 0.1116 | 0.3824 | 8.66e-04 | 3adl:A, 5n8l:A, 5n8m:A |
7 | 2l3j:A | 236 | 66 | 0.2895 | 0.0932 | 0.3333 | 6.55e-05 | 2l3c:A |
8 | 2l3j:A | 236 | 64 | 0.2895 | 0.0932 | 0.3438 | 0.002 | 2l3c:A |
9 | 1yyk:A | 221 | 45 | 0.2237 | 0.0769 | 0.3778 | 1.96e-04 | 2ez6:A, 2ez6:B, 1jfz:A, 1jfz:B, 1jfz:C, 1jfz:D, 4m2z:A, 4m2z:B, 4m30:A, 4m30:B, 2nue:A, 2nuf:A, 2nuf:B, 2nug:A, 2nug:B, 1rc5:A, 1rc5:B, 1rc5:C, 1rc5:D, 1rc7:A, 1yyo:A, 1yyw:A, 1yyw:C, 1yz9:A |
10 | 8dfv:K | 253 | 68 | 0.2632 | 0.0791 | 0.2941 | 6.75e-04 | 8dg5:K |
11 | 7v6c:B | 260 | 62 | 0.2368 | 0.0692 | 0.2903 | 0.002 | |
12 | 1di2:B | 60 | 67 | 0.2237 | 0.2833 | 0.2537 | 0.004 | |
13 | 8e0f:B | 454 | 39 | 0.1711 | 0.0286 | 0.3333 | 0.039 | 6d06:A, 6d06:D, 8e0f:A, 8e4x:A, 8e4x:B, 5ed1:A, 5ed1:D, 5ed2:A, 5ed2:D, 5hp2:A, 5hp2:D, 5hp3:A, 5hp3:D, 7kfn:A, 7kfn:D, 2l2k:B, 6vff:A, 6vff:B, 1zy7:A, 1zy7:B |
14 | 8jkk:D | 383 | 43 | 0.2105 | 0.0418 | 0.3721 | 0.24 | 8jkk:A, 8jkk:G, 8jkk:J, 7w5p:A, 7w5p:H, 7w5p:D, 7w5p:G |
15 | 7zlq:B | 82 | 64 | 0.2105 | 0.1951 | 0.2500 | 1.8 | 7zlq:A |
16 | 8sgd:A | 291 | 38 | 0.1842 | 0.0481 | 0.3684 | 5.2 | 8fwp:A, 8pfh:A, 8sgd:C |
17 | 5x20:A | 312 | 38 | 0.1711 | 0.0417 | 0.3421 | 6.6 | 3wfj:A, 3wfj:B, 3wfj:C, 3wfj:D, 3wfj:E, 3wfj:G, 5x20:B, 5x20:C, 5x20:D, 5x20:E |
18 | 6lkb:A | 160 | 21 | 0.1184 | 0.0563 | 0.4286 | 7.9 | 6lkb:B |
19 | 3rv0:B | 304 | 60 | 0.2500 | 0.0625 | 0.3167 | 9.3 | 3rv0:A, 3rv0:C, 3rv0:D |