MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELD
EIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNGCH
YRGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNP
IMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPIRKRLL
The query sequence (length=307) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4nx2:A | 313 | 306 | 0.9707 | 0.9521 | 0.9739 | 0.0 | 2ag6:A, 7ckg:B, 3d6u:A, 3d6v:A, 2hgz:A, 4hjx:A, 4hjx:B, 4hpw:A, 1j1u:A, 5l7p:B, 3n2y:A, 3n2y:B, 5n5u:A, 4nda:A, 5nsf:B, 5nsf:A, 5nsf:C, 5nsf:D, 4pbr:A, 4pbs:A, 4pbt:A, 2pxh:A, 3qe4:A, 3qe4:B, 6wrk:A, 6wrn:A, 6wrq:A, 6wrt:A, 7ynw:A, 7ynw:B, 1zh0:A, 1zh6:A, 2zp1:A |
2 | 2cyb:A | 319 | 317 | 0.5700 | 0.5486 | 0.5521 | 3.24e-120 | 2cyb:B |
3 | 2cyc:A | 371 | 347 | 0.4332 | 0.3585 | 0.3833 | 5.13e-60 | 2cyc:B |
4 | 7rou:A | 335 | 322 | 0.3746 | 0.3433 | 0.3571 | 2.41e-53 | 1q11:A, 4q93:A, 4qbt:A, 5thh:A |
5 | 2dlc:X | 339 | 330 | 0.3518 | 0.3186 | 0.3273 | 5.65e-53 | |
6 | 7sc6:A | 349 | 329 | 0.3811 | 0.3352 | 0.3556 | 4.91e-50 | 7scq:A, 7scq:B |
7 | 7ror:B | 362 | 316 | 0.3648 | 0.3094 | 0.3544 | 2.32e-47 | 7ror:A, 7ros:A, 7ros:B, 7rot:A, 7rot:B, 3vgj:A, 3vgj:B |
8 | 5usf:A | 682 | 340 | 0.3225 | 0.1452 | 0.2912 | 2.60e-31 | 3p0h:A, 3p0i:A, 3p0j:C, 3p0j:D, 5usf:B |
9 | 5usf:A | 682 | 250 | 0.2280 | 0.1026 | 0.2800 | 2.06e-10 | 3p0h:A, 3p0i:A, 3p0j:C, 3p0j:D, 5usf:B |
10 | 3p0j:A | 657 | 343 | 0.3290 | 0.1537 | 0.2945 | 8.09e-30 | 3p0h:B, 3p0i:B, 3p0j:B |
11 | 3p0j:A | 657 | 218 | 0.2052 | 0.0959 | 0.2890 | 1.38e-10 | 3p0h:B, 3p0i:B, 3p0j:B |
12 | 2j5b:A | 321 | 295 | 0.2769 | 0.2648 | 0.2881 | 6.89e-23 | 2j5b:B |
13 | 1h3f:B | 406 | 248 | 0.2150 | 0.1626 | 0.2661 | 5.89e-15 | 1h3f:A |
14 | 1h3e:A | 427 | 258 | 0.2248 | 0.1616 | 0.2674 | 1.59e-13 | |
15 | 6bqz:A | 215 | 209 | 0.1792 | 0.2558 | 0.2632 | 4.32e-13 | 6bqz:B |
16 | 2a4m:C | 331 | 301 | 0.2410 | 0.2236 | 0.2458 | 3.32e-11 | 1yi8:C, 1yia:B, 1yid:B |
17 | 3a04:A | 367 | 217 | 0.2085 | 0.1744 | 0.2949 | 1.10e-10 | 3a05:A |
18 | 6ncr:A | 342 | 310 | 0.2476 | 0.2222 | 0.2452 | 2.94e-10 | 6ncr:B |
19 | 4j75:A | 374 | 250 | 0.2248 | 0.1845 | 0.2760 | 6.05e-08 | 4j75:B, 4jfa:A, 4jfa:B, 4jfa:D |
20 | 2g36:A | 322 | 235 | 0.1987 | 0.1894 | 0.2596 | 2.30e-07 | |
21 | 2yy5:B | 346 | 326 | 0.2573 | 0.2283 | 0.2423 | 4.86e-07 | 2yy5:A, 2yy5:C, 2yy5:D |
22 | 4jfa:C | 348 | 232 | 0.1889 | 0.1667 | 0.2500 | 6.85e-06 | |
23 | 5ekd:A | 327 | 239 | 0.1987 | 0.1865 | 0.2552 | 2.58e-05 | 5ekd:B |
24 | 3jxe:B | 363 | 206 | 0.1596 | 0.1350 | 0.2379 | 2.00e-04 | 3jxe:A |
25 | 3tzl:B | 320 | 247 | 0.1954 | 0.1875 | 0.2429 | 2.42e-04 | 3tzl:A |
26 | 6dfu:A | 332 | 298 | 0.2150 | 0.1988 | 0.2215 | 0.057 | 6dfu:B |
27 | 3ts1:A | 317 | 57 | 0.0554 | 0.0536 | 0.2982 | 0.23 | 4ts1:A, 4ts1:B, 1tya:E, 1tyb:E, 1tyd:E |
28 | 3sz3:A | 341 | 299 | 0.2150 | 0.1935 | 0.2207 | 0.36 | |
29 | 8i1w:B | 333 | 297 | 0.2182 | 0.2012 | 0.2256 | 0.43 | 8i1y:A, 8i1y:B, 8i1z:A, 8i1z:B, 8i27:A, 8i27:B, 8i2a:B, 8i2a:A, 8i2c:A, 8i2c:B, 8i2j:A, 8i2j:B, 8i2l:B, 8i2l:A, 8i2m:A, 8i2m:B, 8i4i:A, 8i4i:B, 5v0i:A, 5v0i:B |
30 | 3kws:A | 265 | 62 | 0.0717 | 0.0830 | 0.3548 | 0.80 | 3kws:B |
31 | 7cms:A | 328 | 298 | 0.2117 | 0.1982 | 0.2181 | 1.3 | 7cki:A, 7cms:B, 5dk4:A, 7eer:A, 7eer:B, 7eer:C, 7eer:D, 1i6k:A, 1i6l:A, 1i6m:A, 1m83:A, 1mau:A, 1maw:A, 1maw:B, 1maw:C, 1maw:D, 1maw:E, 1maw:F, 1mb2:A, 1mb2:B, 1mb2:C, 1mb2:D, 1mb2:E, 1mb2:F, 2ov4:A |
32 | 3ct4:A | 318 | 45 | 0.0521 | 0.0503 | 0.3556 | 1.4 | 3ct4:B, 3ct4:C |
33 | 3ziu:A | 621 | 80 | 0.0749 | 0.0370 | 0.2875 | 2.9 | 3ziu:B |
34 | 4nv0:B | 300 | 55 | 0.0651 | 0.0667 | 0.3636 | 3.6 | 4nv0:A, 4nwi:A, 4nwi:B |
35 | 4v6w:Ch | 123 | 31 | 0.0391 | 0.0976 | 0.3871 | 3.6 | 6xu6:Ch, 6xu7:Ch, 6xu8:Ch |
36 | 5ko7:B | 200 | 77 | 0.0651 | 0.1000 | 0.2597 | 5.7 | |
37 | 3fhj:D | 286 | 44 | 0.0423 | 0.0455 | 0.2955 | 7.3 | 3fhj:C |
38 | 6tm0:A | 811 | 65 | 0.0586 | 0.0222 | 0.2769 | 7.4 | 6tlz:A, 6tlz:B, 6tm0:B |
39 | 5u75:A | 144 | 43 | 0.0554 | 0.1181 | 0.3953 | 10.0 |