MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLE
INGRNNLIQQKN
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5u6h:A | 92 | 92 | 1.0000 | 1.0000 | 1.0000 | 1.44e-66 | 3d2n:A, 5u9b:A |
2 | 2rpp:A | 89 | 79 | 0.7717 | 0.7978 | 0.8987 | 4.24e-50 | |
3 | 2e5s:A | 98 | 67 | 0.3913 | 0.3673 | 0.5373 | 8.99e-24 | 3d2q:A, 3d2q:B, 3d2q:C, 3d2q:D, 3d2s:A, 3d2s:B, 3d2s:C, 3d2s:D |
4 | 5u6l:A | 83 | 67 | 0.3804 | 0.4217 | 0.5224 | 1.58e-23 | |
5 | 2d9n:A | 77 | 62 | 0.2174 | 0.2597 | 0.3226 | 0.018 | 2rhk:C |
6 | 6dnh:C | 117 | 68 | 0.2174 | 0.1709 | 0.2941 | 0.047 | 8e3i:C, 8e3q:C, 6fuw:C, 8r8r:C, 2rhk:D, 6urg:C, 6uro:C |
7 | 2iu8:A | 346 | 56 | 0.1739 | 0.0462 | 0.2857 | 1.2 | 2iu8:B, 2iu8:C, 2iu9:A, 2iu9:B, 2iu9:C, 2iua:A, 2iua:C |
8 | 3j7a:L | 172 | 42 | 0.1304 | 0.0698 | 0.2857 | 5.2 | 3jbn:L, 3jbo:L, 3jbp:L, 6okk:L, 8tpu:SL |
9 | 7lci:R | 393 | 30 | 0.1087 | 0.0254 | 0.3333 | 8.0 | 7c2e:R, 7duq:R, 7e14:R, 7evm:R, 7fim:R, 8jip:R, 8jir:R, 8jis:R, 7lcj:R, 7lck:R, 5nx2:A, 6orv:RP, 7s15:R, 7s1m:R, 7vbh:R, 7vbi:R, 6vcb:R, 6x19:R, 6x1a:R, 7x8r:R, 7x8s:R, 6xox:R |
10 | 4v6w:AI | 207 | 26 | 0.1087 | 0.0483 | 0.3846 | 9.6 | 6xu6:AI, 6xu7:AI, 6xu8:AI |
11 | 6m5r:B | 689 | 19 | 0.0870 | 0.0116 | 0.4211 | 9.7 | 6m5s:B, 6m5u:B, 6m5v:B |