MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYV
EVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
The query sequence (length=126) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2k2v:A | 126 | 126 | 1.0000 | 1.0000 | 1.0000 | 2.74e-88 | 3urg:A |
2 | 8a3w:R | 178 | 54 | 0.1190 | 0.0843 | 0.2778 | 0.81 | 8a98:R, 6az3:R, 3jcs:R, 8ovj:R, 8rxh:LR, 8rxx:LR, 5t2a:Q |
3 | 5kvu:A | 738 | 67 | 0.1349 | 0.0230 | 0.2537 | 2.1 | 5kvu:B, 5kvu:C, 5kvu:D |
4 | 3di1:B | 291 | 42 | 0.1190 | 0.0515 | 0.3571 | 2.5 | 3di1:A |
5 | 7d38:A | 288 | 73 | 0.1508 | 0.0660 | 0.2603 | 3.7 | 7d39:A, 7d3a:A, 7d3b:A |
6 | 7oz9:BBB | 483 | 48 | 0.0952 | 0.0248 | 0.2500 | 4.0 | 7oz9:AAA |
7 | 8jbi:C | 157 | 89 | 0.1746 | 0.1401 | 0.2472 | 5.4 | 8jbi:D, 8jbi:A, 8jbi:B |
8 | 1sjg:A | 112 | 29 | 0.1032 | 0.1161 | 0.4483 | 6.8 | 4p1b:H, 4p1b:I, 4p1c:H, 4p1c:I, 2q3w:A, 1vm9:A |
9 | 2fsn:B | 311 | 45 | 0.1111 | 0.0450 | 0.3111 | 8.6 | 2fsn:A |