MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAK
ELIEKYGI
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3epy:A | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 1.42e-59 | 3epy:B |
2 | 1aca:A | 86 | 85 | 0.6023 | 0.6163 | 0.6235 | 1.87e-32 | 2cb8:A, 2cb8:B, 2fj9:A, 1nvl:A |
3 | 3fp5:A | 106 | 89 | 0.4318 | 0.3585 | 0.4270 | 1.12e-17 | |
4 | 7fc7:A | 96 | 90 | 0.3864 | 0.3542 | 0.3778 | 4.73e-15 | |
5 | 2wh5:A | 90 | 86 | 0.3523 | 0.3444 | 0.3605 | 2.47e-12 | 2wh5:B, 2wh5:C, 2wh5:D, 2wh5:F, 2wh5:E |
6 | 3flv:A | 92 | 85 | 0.2841 | 0.2717 | 0.2941 | 1.66e-09 | 3flv:B |
7 | 1hbk:A | 89 | 61 | 0.2500 | 0.2472 | 0.3607 | 2.42e-06 | |
8 | 8azw:r | 386 | 34 | 0.1477 | 0.0337 | 0.3824 | 4.7 | 8b2l:r3, 7qiw:E, 7qiz:E |
9 | 3l24:B | 417 | 45 | 0.1591 | 0.0336 | 0.3111 | 5.3 | 3l24:C, 3l7g:B, 3l7g:C |
10 | 6nz4:A | 467 | 70 | 0.2386 | 0.0450 | 0.3000 | 7.9 | 6nz4:B, 6nz5:B, 6nz6:A, 6nz6:B |
11 | 6xux:A | 879 | 51 | 0.2045 | 0.0205 | 0.3529 | 8.7 | |
12 | 5gw7:B | 760 | 51 | 0.2045 | 0.0237 | 0.3529 | 9.6 | 5ca3:A, 5ca3:B, 3d3i:A, 3d3i:B, 5gw7:A, 3w7s:A, 3w7s:B, 3w7t:A, 3w7t:B, 3w7u:A, 3w7u:B, 3w7w:A, 3w7w:B, 3w7x:A, 3w7x:B |