MAKIILRHLIGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHD
GILVVEVK
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6f2r:Q | 89 | 89 | 1.0000 | 0.9888 | 0.9888 | 1.35e-58 | 6f2r:T, 6f2r:V |
2 | 6gjh:F | 87 | 82 | 0.3750 | 0.3793 | 0.4024 | 2.17e-18 | 6gjh:D, 6gjh:H, 6gjh:B, 4mjh:A, 4mjh:C |
3 | 5lum:A | 78 | 74 | 0.3295 | 0.3718 | 0.3919 | 9.77e-18 | 5lum:B, 5lum:D, 5lum:C, 5lum:E |
4 | 3l1e:A | 105 | 73 | 0.3523 | 0.2952 | 0.4247 | 1.66e-16 | |
5 | 4m5s:A | 87 | 74 | 0.3182 | 0.3218 | 0.3784 | 1.58e-14 | 4m5t:A, 4m5t:C, 4m5t:E, 4m5t:G |
6 | 5xw6:C | 320 | 28 | 0.1705 | 0.0469 | 0.5357 | 0.24 | 5xw6:B, 5xw6:A |
7 | 3m85:I | 259 | 65 | 0.2386 | 0.0811 | 0.3231 | 1.2 | 3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H |
8 | 6z2p:A | 356 | 38 | 0.1477 | 0.0365 | 0.3421 | 3.0 | 6z2d:A, 6z2o:A, 6z2q:A |
9 | 6sl1:A | 2652 | 86 | 0.2500 | 0.0083 | 0.2558 | 4.1 | 6sky:A, 6sky:B |
10 | 6n7p:B | 195 | 23 | 0.1136 | 0.0513 | 0.4348 | 4.4 | 6g90:C, 6n7r:B, 6n7x:B, 7oqc:C, 7oqe:C, 5zwn:R |
11 | 4ufc:B | 788 | 28 | 0.1136 | 0.0127 | 0.3571 | 6.8 | 4ufc:A |
12 | 8he5:O | 516 | 47 | 0.1818 | 0.0310 | 0.3404 | 7.0 | |
13 | 1xzq:A | 449 | 25 | 0.1250 | 0.0245 | 0.4400 | 7.5 | 1xzq:B |
14 | 4lqy:A | 379 | 66 | 0.1591 | 0.0369 | 0.2121 | 7.7 | 4lr2:A |