LYEFVGLLDAHGNVLEVNQVALEGGGITMEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGRE
VIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALKNQEL
The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5hww:A | 128 | 124 | 0.9840 | 0.9609 | 0.9919 | 6.27e-88 | 5hwv:A, 5hwv:B, 5hww:B |
2 | 2vqi:B | 477 | 41 | 0.1040 | 0.0273 | 0.3171 | 0.18 | |
3 | 4v8m:AY | 65 | 67 | 0.1360 | 0.2615 | 0.2537 | 0.32 | 7ase:c, 5opt:c, 8ova:AY, 8ove:AY |
4 | 5lj3:C | 882 | 39 | 0.1120 | 0.0159 | 0.3590 | 1.7 | 6exn:C, 5gam:C, 5gan:C, 5lj5:C, 5lqw:B, 5mps:C, 5mq0:C, 5nrl:C |
5 | 3bwl:A | 125 | 37 | 0.0960 | 0.0960 | 0.3243 | 1.9 | 3bwl:B, 3bwl:C, 3bwl:D |
6 | 1g6i:A | 510 | 38 | 0.0880 | 0.0216 | 0.2895 | 2.0 | |
7 | 3n4e:A | 368 | 31 | 0.0880 | 0.0299 | 0.3548 | 2.7 | 3n4e:B |
8 | 6vu9:A | 631 | 52 | 0.1360 | 0.0269 | 0.3269 | 2.8 | |
9 | 6dgj:A | 102 | 29 | 0.0800 | 0.0980 | 0.3448 | 5.2 | |
10 | 5ykw:A | 106 | 34 | 0.0800 | 0.0943 | 0.2941 | 5.5 | |
11 | 2d00:B | 109 | 31 | 0.1120 | 0.1284 | 0.4516 | 6.0 | 2d00:C, 2d00:A, 2d00:D |