LVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFVYASGLEEDEESGLSL
The query sequence (length=54) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3jcu:W | 54 | 54 | 1.0000 | 1.0000 | 1.0000 | 1.71e-32 | 3jcu:w, 7oui:W, 7oui:w, 6yp7:W |
2 | 8c29:w | 54 | 54 | 0.7778 | 0.7778 | 0.7778 | 2.26e-22 | |
3 | 6kac:W | 56 | 56 | 0.5370 | 0.5179 | 0.5179 | 8.66e-15 | 6kac:w, 6kad:W, 6kad:w |
4 | 7pi0:W | 44 | 44 | 0.4444 | 0.5455 | 0.5455 | 1.71e-13 | 7pi0:w, 7pin:w, 7pin:W1, 7pin:w1, 7piw:W, 7piw:w1 |
5 | 8bd3:W | 60 | 60 | 0.4074 | 0.3667 | 0.3667 | 6.95e-07 | 8bd3:w |
6 | 7jrg:C | 388 | 24 | 0.1667 | 0.0232 | 0.3750 | 1.7 | 8bel:C, 8bel:M, 8bpx:AC, 8bpx:BC, 8bq5:AC, 8bq5:BC, 8bq6:AC, 8bq6:BC, 8e73:C, 8e73:O, 7jrg:O, 7jrp:C, 7jrp:O |
7 | 7xnk:A | 348 | 31 | 0.2222 | 0.0345 | 0.3871 | 3.3 | 7tci:A, 7tci:G, 7tci:E, 7tci:C, 4umo:A, 6v01:A, 6v01:J, 6v01:D, 6v01:G, 7xnk:C, 7xnk:E, 7xnk:G, 7xnl:A, 7xnl:C, 7xnl:E, 7xnl:G, 7xnn:B, 7xnn:G, 7xnn:C, 7xnn:E |
8 | 5env:A | 347 | 26 | 0.1667 | 0.0259 | 0.3462 | 8.2 | 5env:B, 7kc2:A, 7kc2:B, 7kc2:C, 7kc2:D, 7kcb:A, 7kcb:B, 7kcb:C, 7kcb:D, 7kcq:A, 7kcq:B, 7kcq:C, 7kcq:D, 7kjy:A, 7kjy:B, 7kjy:C, 7kjy:D, 7ntm:A, 7ntm:B, 7ntm:D, 7ntm:C, 4w6z:A, 4w6z:B, 4w6z:C, 4w6z:D |