BioLiP

>protein
LTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLK
DEKEKLLKEKGENDKSLHLLKKQLS

The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7x5e:B	106	105	1.0000	0.9906	1.0000	5.28e-71	7x5e:F, 7x5f:B, 7x5f:F, 7x5g:B, 7x5g:F
2	1skn:P	74	66	0.2381	0.3378	0.3788	5.36e-10
3	5vpe:D	67	42	0.1810	0.2836	0.4524	1.38e-04	5vpe:B, 5vpf:B, 5vpf:D
4	5t01:A	62	38	0.1619	0.2742	0.4474	0.002	1a02:J, 1fos:F, 1fos:H, 5fv8:D, 2h7h:A, 2h7h:B, 1jnm:A, 1jnm:B, 1s9k:E, 5t01:B
5	2wt7:A	63	40	0.1714	0.2857	0.4500	0.008	1a02:F, 1fos:E, 1fos:G, 1s9k:D
6	2wty:B	97	83	0.1905	0.2062	0.2410	0.30	4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A
7	6x35:B	3801	59	0.1714	0.0047	0.3051	0.48	6x35:E, 6x35:H, 6x35:K
8	6w1n:B	3719	59	0.1714	0.0048	0.3051	0.48	6w1n:D, 6w1n:F, 6w1n:H, 6x34:B, 6x34:D, 6x34:F, 6x34:H
9	6x32:B	3798	59	0.1714	0.0047	0.3051	0.48	6x32:E, 6x32:H, 6x32:K
10	6x33:B	3816	59	0.1714	0.0047	0.3051	0.48	8drp:A, 8drp:B, 8drp:C, 8drp:D, 6x33:E, 6x33:H, 6x33:K
11	7x5e:E	101	72	0.1810	0.1881	0.2639	0.95	3a5t:A, 3a5t:B, 7x5e:A, 7x5f:A, 7x5f:E, 7x5g:A, 7x5g:E
12	4eot:A	92	77	0.1810	0.2065	0.2468	1.3	4eot:B
13	5a22:A	2002	37	0.1048	0.0055	0.2973	3.2
14	6u1x:A	2059	37	0.1048	0.0053	0.2973	3.2
15	5uba:A	261	42	0.0762	0.0307	0.1905	6.0
16	7eip:A	966	65	0.1619	0.0176	0.2615	7.0	7eiq:A, 7eir:A, 7eis:A, 7yke:A
17	5eqg:A	447	27	0.0762	0.0179	0.2963	8.9	5eqh:A, 5eqi:A
18	1nbw:A	606	24	0.1048	0.0182	0.4583	9.7	1nbw:C
19	5fgn:A	536	35	0.1429	0.0280	0.4286	10.0	4kav:A, 4kay:A, 4kay:B

[Back]