BioLiP

>protein
LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKN
YLVAQGRRLEL

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6jbq:F	186	88	0.9670	0.4731	1.0000	2.10e-60	2h27:A, 2h27:D, 4lup:A, 4lup:C, 2map:A
2	5or5:A	95	91	0.9341	0.8947	0.9341	4.90e-57
3	6in7:B	174	87	0.6703	0.3506	0.7011	6.84e-40
4	4cxf:A	154	92	0.3846	0.2273	0.3804	3.24e-15
5	6kop:F	159	41	0.1978	0.1132	0.4390	1.78e-05	6koq:F
6	6jcy:F	164	42	0.1978	0.1098	0.4286	2.65e-05
7	6jcx:F	186	41	0.1978	0.0968	0.4390	2.78e-05	6kon:F, 6koo:F, 5zx2:F
8	7l7b:F	272	76	0.2857	0.0956	0.3421	0.097
9	7ckq:F	272	77	0.2308	0.0772	0.2727	0.65	7f75:F, 8x6f:E
10	4iaw:A	180	48	0.1648	0.0833	0.3125	4.4	3dsz:A, 3dsz:B, 4iaw:B, 4iaw:C, 4iax:A
11	7msc:Y	68	32	0.1319	0.1765	0.3750	5.6	7f0d:Y, 7kgb:Y, 7msh:Y, 7msm:Y, 7msz:Y, 7mt2:Y, 7mt3:Y, 7mt7:Y, 7sfr:Y, 5v7q:Y, 5v93:Y
12	5dx6:B	557	38	0.1429	0.0233	0.3421	7.1	5d6r:B, 5d6r:M, 5dx6:A, 1ozf:A, 1ozf:B, 1ozg:A, 1ozg:B, 1ozh:A, 1ozh:B, 1ozh:C, 1ozh:D, 5wdg:A, 5wdg:B
13	6g1y:B	493	50	0.1319	0.0243	0.2400	7.3	6g1y:A, 6g1z:A, 6g1z:B, 6g20:A, 6g20:B
14	5swc:A	223	25	0.1099	0.0448	0.4000	7.5	5swc:B, 5swc:C, 5swc:D, 5swc:E, 5swc:F
15	4b45:A	334	37	0.1758	0.0479	0.4324	9.7

[Back]