LSSGINLGRLRLAEQFSSMNGWQSKEDPAFDAYVKERRRKENYEAFDQRVERGYAAAAKLHKAEIQNAVKRRLKSSGAKF
TAETLREMSSAVTERLAWLRDVWAQIDADYRSGDSARQETAAQEISAALRGEPNDYMRWVYETKRELRFAGPVGRRAIQE
ELQAAELPEVLDEEVNRYHDLKLNMMEIEREVKAKYGVAGQQHWAELQAAKDEEYI
The query sequence (length=216) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7pua:F9 | 540 | 216 | 1.0000 | 0.4000 | 1.0000 | 3.11e-154 | 7pub:F9, 6sga:F9, 6sgb:F9 |
2 | 7p06:A | 1350 | 61 | 0.0787 | 0.0126 | 0.2787 | 2.2 | |
3 | 7p04:A | 1353 | 61 | 0.0787 | 0.0126 | 0.2787 | 2.2 | 7p05:A |
4 | 5tu0:A | 385 | 43 | 0.0602 | 0.0338 | 0.3023 | 4.8 | |
5 | 7qep:M3 | 161 | 49 | 0.0880 | 0.1180 | 0.3878 | 7.3 | |
6 | 5x7o:A | 1247 | 24 | 0.0556 | 0.0096 | 0.5000 | 8.2 | 5x7o:B, 5x7p:B, 5x7p:A, 5x7q:A, 5x7q:B, 5x7r:A, 5x7r:B, 5x7s:A, 5x7s:B |
7 | 5u1g:D | 211 | 73 | 0.0787 | 0.0806 | 0.2329 | 9.9 | 4dzz:A, 4dzz:B, 4e03:A, 4e03:B, 4e07:A, 4e07:B, 4e09:A, 5u1g:B, 5u1g:C, 5u1g:A |