Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP Library
>protein
LSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNNCAKGVDDQKKDKRFVNDTLRSEFHKK
FMEKYIK

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6zym:R 87 87 1.0000 1.0000 1.0000 3.01e-60
2 6id0:P 118 98 1.0000 0.7373 0.8878 2.05e-56 8c6j:P, 8ch6:Q, 6ff4:R, 6ff7:R, 8i0s:P, 8i0t:P, 8i0u:P, 8i0v:P, 8i0w:P, 6icz:P, 6id1:P, 5mqf:R, 7qtt:Q, 7w59:P, 7w5a:P, 7w5b:P, 5xjc:P, 5yzg:P, 5z56:P, 5z57:P
3 9fmd:P 106 87 0.8736 0.7170 0.8736 1.08e-34 6qdv:P
4 8ro2:P 112 112 0.8506 0.6607 0.6607 4.40e-31
5 8ro0:P 150 128 0.6552 0.3800 0.4453 3.07e-30 8ro1:P
6 3jb9:h 90 89 0.4828 0.4667 0.4719 3.82e-17
7 7b9v:P 74 78 0.2069 0.2432 0.2308 0.059 6bk8:H, 7dco:S, 6exn:P, 5gm6:S, 5gmk:S, 6j6g:S, 6j6h:S, 6j6n:S, 6j6q:S, 5lj3:P, 5lj5:P, 5mps:P, 5mq0:P, 5wsg:S, 5y88:P, 5ylz:P
8 7qep:M6 196 33 0.1494 0.0663 0.3939 7.2

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417