LSPINDPLLMSILNRLQFNLNNDIQLKTEG
The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5kc1:G | 33 | 30 | 1.0000 | 0.9091 | 1.0000 | 4.47e-15 | 5kc1:E |
| 2 | 8a3w:SE | 260 | 15 | 0.3000 | 0.0346 | 0.6000 | 7.4 | 8a98:SE, 6az1:E, 8ovj:SE, 8rxh:SE, 8rxx:SE, 5t2a:1 |
zhanggroup.org